[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50410.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.281.1
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->126 2pihA1  a.281.1.1 * 4e-09 18.9 %
:HMM:PFM   21->125 PF06133 * DUF964 1.7e-26 35.2 105/108  
:BLT:SWISS 17->124 Y1594_DESHY 8e-10 31.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50410.1 GT:GENE ABO50410.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2075763..2076185) GB:FROM 2075763 GB:TO 2076185 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dsy:DSY1594 hypothetical protein GB:PROTEIN_ID ABO50410.1 GB:DB_XREF GI:134052439 LENGTH 140 SQ:AASEQ MVPSINSLISLGEVKNMSNVVLERALELGKLIAQSEEYKTMRAKEAAMMADVDALALIEKFQQLQQSHQMYRMQGKELTDEQLNDAHAMEDQMMGNNLIREFAEIQEKFQKFLNQVNDQISEGIEGPKEPQGCSSCGTFS GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 17->124|Y1594_DESHY|8e-10|31.5|108/131| SEG 46->57|aammadvdalal| HM:PFM:NREP 1 HM:PFM:REP 21->125|PF06133|1.7e-26|35.2|105/108|DUF964| RP:SCP:NREP 1 RP:SCP:REP 21->126|2pihA1|4e-09|18.9|106/123|a.281.1.1| OP:NHOMO 7 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--23--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,70-83| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //