[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50415.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:51 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->39 1y9dD PDBj 2e-05 48.6 %
:RPS:PDB   1->45 1bfdA PDBj 5e-07 20.9 %
:RPS:SCOP  1->45 1bfdA2  c.36.1.5 * 5e-08 20.9 %
:HMM:SCOP  1->45 1ybhA2 c.36.1.5 * 2.1e-07 46.7 %
:RPS:PFM   5->45 PF02776 * TPP_enzyme_N 2e-05 48.8 %
:HMM:PFM   1->45 PF02776 * TPP_enzyme_N 2.8e-14 46.7 45/172  
:BLT:SWISS 4->45 POXB_STRPN 9e-07 42.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50415.1 GT:GENE ABO50415.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2083115..2083270) GB:FROM 2083115 GB:TO 2083270 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50415.1 GB:DB_XREF GI:134052444 LENGTH 51 SQ:AASEQ MVAWGVKNVFGVVGDGIFYLLDALARQNTIKYYAVRHEETASLMAPRPMLN GT:EXON 1|1-51:0| BL:SWS:NREP 1 BL:SWS:REP 4->45|POXB_STRPN|9e-07|42.9|42/591| TM:NTM 1 TM:REGION 3->25| BL:PDB:NREP 1 BL:PDB:REP 3->39|1y9dD|2e-05|48.6|37/560| RP:PDB:NREP 1 RP:PDB:REP 1->45|1bfdA|5e-07|20.9|43/523| RP:PFM:NREP 1 RP:PFM:REP 5->45|PF02776|2e-05|48.8|41/170|TPP_enzyme_N| HM:PFM:NREP 1 HM:PFM:REP 1->45|PF02776|2.8e-14|46.7|45/172|TPP_enzyme_N| GO:PFM:NREP 1 GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02776|IPR012001| RP:SCP:NREP 1 RP:SCP:REP 1->45|1bfdA2|5e-08|20.9|43/180|c.36.1.5| HM:SCP:REP 1->45|1ybhA2|2.1e-07|46.7|45/0|c.36.1.5|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 88.2 SQ:SECSTR HHHTTccEEEEcccGGGHHHHTTccTTcccEEEEcccHHHHHHHH###### DISOP:02AL 51-52| PSIPRED cHHccccEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHccccccc //