[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50423.1
DDBJ      :             integral membrane sensor signal transduction histidine kinase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  861/915 : Eukaryota  121/199 : Viruses  1/175   --->[See Alignment]
a.154.1a.30.2d.122.1
:493 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   257->485 3dgeA PDBj 5e-36 33.8 %
:RPS:PDB   210->253 2aswA PDBj 1e-04 25.0 %
:RPS:PDB   234->485 2bu6A PDBj 2e-39 14.4 %
:RPS:SCOP  221->258 1l8wA  a.154.1.1 * 1e-05 18.4 %
:RPS:SCOP  249->330 2c2aA1  a.30.2.1 * 3e-15 37.8 %
:RPS:SCOP  335->485 1id0A  d.122.1.3 * 6e-29 20.5 %
:HMM:SCOP  244->331 2c2aA1 a.30.2.1 * 1.3e-20 40.9 %
:HMM:SCOP  318->483 1jm6A2 d.122.1.4 * 7.8e-47 41.5 %
:RPS:PFM   268->328 PF00512 * HisKA 3e-11 55.0 %
:RPS:PFM   378->482 PF02518 * HATPase_c 2e-22 44.8 %
:HMM:PFM   376->483 PF02518 * HATPase_c 4.2e-33 43.0 107/111  
:HMM:PFM   263->329 PF00512 * HisKA 3.3e-21 51.5 66/68  
:HMM:PFM   183->250 PF00672 * HAMP 2.7e-19 33.8 68/70  
:HMM:PFM   298->364 PF09657 * Cas_Csx8 0.00022 25.8 66/441  
:BLT:SWISS 141->482 YCLK_BACSU 3e-45 33.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50423.1 GT:GENE ABO50423.1 GT:PRODUCT integral membrane sensor signal transduction histidine kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2090331..2091812) GB:FROM 2090331 GB:TO 2091812 GB:DIRECTION - GB:PRODUCT integral membrane sensor signal transduction histidine kinase GB:NOTE PFAM: ATP-binding region, ATPase domain protein domain protein; histidine kinase, HAMP region domain protein; histidine kinase A domain protein domain protein KEGG: dsy:DSY4622 hypothetical protein GB:PROTEIN_ID ABO50423.1 GB:DB_XREF GI:134052452 InterPro:IPR003594 InterPro:IPR003660 InterPro:IPR003661 InterPro:IPR004358 InterPro:IPR005467 InterPro:IPR008358 LENGTH 493 SQ:AASEQ MIGGSIVKKLWLATSLLVLLAMGASTLTQMWLLKSTYYDQQIEQLLEATRKLAVKIQIDEPMAVAQEMEYLADNLQGATAFLVNRDGQIIYKTRGGWSRGPKHQMGMHGNGYGMYGILTGLNMKDILAGKEIIFKGHHPMFGVDVITVAVPVKKEEIIGEVLVLSTPRQAIDTNIKALQSMSVYSLLFGLVLATLFSWLLSRSLSRPLLKMKDVANAMSRGDYSRSINIKSKDEIGMLADSLNTLSHDLEEKINQLRRIDDTRRDFVAGVSHELRTPLTIIQGNAEALLDGVIEDKDKQRDFLINIYEESLRLKRLSNELLDMRKIETGQVNLYKEKVNASEIFFNVVSRMQHLAKQRGIILNLSVPEQPVILYLDTDRLGQVLINLIDNALRFSRSEVTIELKDFPDKIKVQISDNGPGIPEAERNLVWDKFYKVDKSRSRSAGGTGLGLSIVKQLIELHGGTVCLTSREGEGTTFIFTIPKEQGGKSTGQN GT:EXON 1|1-493:0| BL:SWS:NREP 1 BL:SWS:REP 141->482|YCLK_BACSU|3e-45|33.0|339/473| TM:NTM 2 TM:REGION 3->25| TM:REGION 180->202| SEG 10->20|lwlatsllvll| SEG 105->116|mgmhgngygmyg| SEG 195->209|lfswllsrslsrpll| BL:PDB:NREP 1 BL:PDB:REP 257->485|3dgeA|5e-36|33.8|228/237| RP:PDB:NREP 2 RP:PDB:REP 210->253|2aswA|1e-04|25.0|44/56| RP:PDB:REP 234->485|2bu6A|2e-39|14.4|243/353| RP:PFM:NREP 2 RP:PFM:REP 268->328|PF00512|3e-11|55.0|60/69|HisKA| RP:PFM:REP 378->482|PF02518|2e-22|44.8|105/112|HATPase_c| HM:PFM:NREP 4 HM:PFM:REP 376->483|PF02518|4.2e-33|43.0|107/111|HATPase_c| HM:PFM:REP 263->329|PF00512|3.3e-21|51.5|66/68|HisKA| HM:PFM:REP 183->250|PF00672|2.7e-19|33.8|68/70|HAMP| HM:PFM:REP 298->364|PF09657|0.00022|25.8|66/441|Cas_Csx8| GO:PFM:NREP 4 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF00512|IPR003661| GO:PFM GO:0007165|"GO:signal transduction"|PF00512|IPR003661| GO:PFM GO:0016020|"GO:membrane"|PF00512|IPR003661| GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 3 RP:SCP:REP 221->258|1l8wA|1e-05|18.4|38/271|a.154.1.1| RP:SCP:REP 249->330|2c2aA1|3e-15|37.8|82/89|a.30.2.1| RP:SCP:REP 335->485|1id0A|6e-29|20.5|146/146|d.122.1.3| HM:SCP:REP 244->331|2c2aA1|1.3e-20|40.9|88/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| HM:SCP:REP 318->483|1jm6A2|7.8e-47|41.5|164/190|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 16175 OP:NHOMOORG 1010 OP:PATTERN -----------------------5K4444I7D--11-1222244E-7C7PG39--------------7 CYr5L46677764589966-6F44BC666668HEFF7AEB8GCG976458759AC44711CCU4O5CJHL8444465557L9812567ji*d-k433--D7d8NG*awWl1111111---11112533B655CAK6hhdccJ9Es3*dwtZZHEI9A433686RXCb***L352332362322TIA44345FCIVVYUZXXZMaYbfbWKLIHIJabiDGHR7OI999A89ro79988887889998876775A67688645466655BA655565575ABA755566666666666666555555555655563344233366bLO*RRQVVVUTTQFdaZDHJGQNJ56BHJH5fcUIGA46A57675327PLSnaaQ56787OJgXdLEHZUUTXCDDDDDCBDCJ-QSdPTXUlJQT4XUUVURSYdWNNNRIFNJCJHIJIETF777777779A979*TT3323311133493255334334334111136IJ986A97FfVZbecXIJJFXWjmNNOODMcdjUbai-7OTKhUVFFaYTPW5MPZFHCCXD333333388ILZ*Y*tOGHyVA*rdaf3*v*****KYok*q**FdA414522222111--1--1-CE45I99TMCcYUVEeUHQLPQPKOLQMNORONSQZZ--2DAJH------KJGGGIDLKKMLMLNKL-KNMKLLLKKLKLLJLLLLIOOPFIDDAKJJKJLKKJKMKMKKNKIHDHGIL8-IGHIJJIEHJJI--4B777778988AMxEY333333132233234FFDEG8F487KOVVcVYplpTZZgXSedf322213312BKNLSLMLMMSTSXXYTSQWQRNPP8989--*4bbGIMM111212223-2-------------------------6C666565557w4 --1-DD1------1H67776576858644333333344443444447977773A66566889332111-411322-1-1113334323-3627352444285367B-A1M------------------------------------------------5----3---------3--444L11212g48H79F4-G2432 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------3- STR:NPRED 327 STR:RPRED 66.3 SQ:SECSTR ######################################################################################################################################################################cHHHHHHHTcccccccHHHHHGGGccHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHTcHHHHHHHHHHHHHHHHHHHHHHGGGcccTTcTTTTHHHHHHHHHHHHHTTTHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTTcEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEETTcccEEEEcHHHHHHHHHHHHHHHHHHHHHHTTTEEEEcccEEEEEEEEEEEcccHHHHHHHTcTTTTccccccccccccccHHHHHHHHHHHTTcEEEEEEETTEEEEEEEEEEccTTEEEccTT DISOP:02AL 1-3,99-107,439-441,482-494| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEcccEEEEEcccccccccHHHHHccccccHHHHHccHHHHHHHHccccEEEEEEEcccccEEEEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEcHHHHHHHHHHHHHcHHEEccccEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEccccccccccc //