[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50428.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->62 3c2hB PDBj 4e-04 33.3 %
:HMM:PFM   19->57 PF01710 * Transposase_14 0.00011 36.8 38/120  
:PROS 24->30|PS00307|LECTIN_LEGUME_BETA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50428.1 GT:GENE ABO50428.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2097343..2097567) GB:FROM 2097343 GB:TO 2097567 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1106 hypothetical protein GB:PROTEIN_ID ABO50428.1 GB:DB_XREF GI:134052457 InterPro:IPR001220 LENGTH 74 SQ:AASEQ MEEYLRSRVPWSTEPSLETKAKEVGVDFDTLIEGIKNNKSDEELAEEFDVTPKCIGYLKEHFWTHGIGSIMGQD GT:EXON 1|1-74:0| PROS 24->30|PS00307|LECTIN_LEGUME_BETA|PDOC00278| BL:PDB:NREP 1 BL:PDB:REP 11->62|3c2hB|4e-04|33.3|51/618| HM:PFM:NREP 1 HM:PFM:REP 19->57|PF01710|0.00011|36.8|38/120|Transposase_14| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 68.9 SQ:SECSTR ##########GGGcTTTHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcc#HHHHHHHHGGG############ DISOP:02AL 1-3,73-75| PSIPRED cHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHcHHHHHccc //