[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50432.1
DDBJ      :             metal dependent phosphohydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   40->172 2dqbD PDBj 6e-07 25.0 %
:RPS:SCOP  40->172 1vqrA  a.211.1.3 * 2e-07 12.4 %
:HMM:SCOP  46->172 1vqrA_ a.211.1.3 * 2.1e-06 29.7 %
:RPS:PFM   56->148 PF08668 * HDOD 1e-04 39.7 %
:HMM:PFM   45->172 PF01966 * HD 2e-16 31.9 94/118  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50432.1 GT:GENE ABO50432.1 GT:PRODUCT metal dependent phosphohydrolase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2101079..2101600 GB:FROM 2101079 GB:TO 2101600 GB:DIRECTION + GB:PRODUCT metal dependent phosphohydrolase GB:NOTE TIGRFAM: metal dependent phophohydrolase PFAM: metal-dependent phosphohydrolase, HD sub domain KEGG: cno:NT01CX_0854 hypothetical protein GB:PROTEIN_ID ABO50432.1 GB:DB_XREF GI:134052461 InterPro:IPR006674 InterPro:IPR006675 LENGTH 173 SQ:AASEQ MLTRIRQFWFAIFSKMGSEDIQFVQSHLTLEEQSLFFQMDRPTQTHCLRVANTCLKLLGYNSGLDQKILIKAALLHDIGKPANLITTIDRVLIVLLGALTRKPIEDLLKVLKGRGRFSKVLSAHAMHPQKGAVMARNFGLPQEIINLIEKHHQPIQSADPSELAILKKADELN GT:EXON 1|1-173:0| RP:PDB:NREP 1 RP:PDB:REP 40->172|2dqbD|6e-07|25.0|112/357| RP:PFM:NREP 1 RP:PFM:REP 56->148|PF08668|1e-04|39.7|78/194|HDOD| HM:PFM:NREP 1 HM:PFM:REP 45->172|PF01966|2e-16|31.9|94/118|HD| RP:SCP:NREP 1 RP:SCP:REP 40->172|1vqrA|2e-07|12.4|121/284|a.211.1.3| HM:SCP:REP 46->172|1vqrA_|2.1e-06|29.7|118/0|a.211.1.3|1/1|HD-domain/PDEase-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------1-1--111-11-1------1--1-1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 97.1 SQ:SECSTR ####cccccccHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHTTTTcccccTHHcHHHHHHHHHccccHHHHHHHHHTTTTTcccHHHHHHHHTTccccTTcccccccHHHHHHHHHccccccccccHHHHHHHHHHHH# DISOP:02AL 1-1,172-174| PSIPRED cHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHcc //