[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50437.1
DDBJ      :             Stage V sporulation protein S
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->84 2ek0A PDBj 3e-24 57.1 %
:RPS:PDB   1->86 2ek0A PDBj 4e-34 55.8 %
:RPS:PFM   2->84 PF04232 * SpoVS 2e-29 89.2 %
:HMM:PFM   1->86 PF04232 * SpoVS 7.5e-48 79.1 86/86  
:BLT:SWISS 1->86 SP5S_BACSU 3e-33 79.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50437.1 GT:GENE ABO50437.1 GT:PRODUCT Stage V sporulation protein S GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2105228..2105488) GB:FROM 2105228 GB:TO 2105488 GB:DIRECTION - GB:PRODUCT Stage V sporulation protein S GB:NOTE PFAM: Stage V sporulation protein S KEGG: gka:GK1299 stage V sporulation protein S GB:PROTEIN_ID ABO50437.1 GB:DB_XREF GI:134052466 InterPro:IPR007347 LENGTH 86 SQ:AASEQ MEVLKVSAKSNPNSVAGALAGVLRERGCAEMQAIGAGALNQAVKAIAIARGFVAPSGVDLICIPAFTDVVIDGDERTAIKLIVEPR GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 1->86|SP5S_BACSU|3e-33|79.1|86/100| BL:PDB:NREP 1 BL:PDB:REP 1->84|2ek0A|3e-24|57.1|84/90| RP:PDB:NREP 1 RP:PDB:REP 1->86|2ek0A|4e-34|55.8|86/90| RP:PFM:NREP 1 RP:PFM:REP 2->84|PF04232|2e-29|89.2|83/86|SpoVS| HM:PFM:NREP 1 HM:PFM:REP 1->86|PF04232|7.5e-48|79.1|86/86|SpoVS| OP:NHOMO 152 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111------------------------------------------------------11111---11-------------------------------------1111111-1112222222212222221111112221111111------11------------------------------------------------------------------------------------------21121111111111111111111--2--2--21111111231222321---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2222232333--- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 100.0 SQ:SECSTR ccEEEEcTTccHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEEEETTEEEEEEEEEEEEE DISOP:02AL 1-1,6-7| PSIPRED cEEEEEEccccccHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHEEEEEcccccEEEEEEEEEEEEEccEEEEEEEEEEEcc //