[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50445.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->86 PF07954 * DUF1689 0.00034 25.0 40/152  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50445.1 GT:GENE ABO50445.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2114632..2115201) GB:FROM 2114632 GB:TO 2115201 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1076 hypothetical protein GB:PROTEIN_ID ABO50445.1 GB:DB_XREF GI:134052474 LENGTH 189 SQ:AASEQ MQWHGLKLPVIFMTFVLGLALVFAGQWAYKEYSYQQPLSKVLAENELVEDFTIKEGTSKSLVKVELSKDTSNLMVAYQEINQLINEVMGQKHYQIKFMSKSDNALNQAFYESHHIIYQAQVMGNYPEAAQKVEEAARKQGAEGKVFVDENNIYIQFSKTDGHYLYQIIPRQDHGKTVTTQGGGQIAERN GT:EXON 1|1-189:0| TM:NTM 1 TM:REGION 6->28| HM:PFM:NREP 1 HM:PFM:REP 6->86|PF07954|0.00034|25.0|40/152|DUF1689| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,182-182,184-190| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEccccEEEEEEEccccEEEEEEEcccccccccccccccccccc //