Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50450.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:HMM:PFM   16->24 PF08483 * IstB_N 0.00062 66.7 9/30  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50450.1 GT:GENE ABO50450.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2118740..2119003 GB:FROM 2118740 GB:TO 2119003 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50450.1 GB:DB_XREF GI:134052479 LENGTH 87 SQ:AASEQ MLTVRRLSLEEILDLEWLALLVDQVLEYNYYTVPLEEKHLKMIQLSVNGSLDMETIASYIVDYLSPEAINFNYQYKDHSSLSQDEVG GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 16->24|PF08483|0.00062|66.7|9/30|IstB_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,81-88| PSIPRED ccEEEEccHHHHHcHHHHHHHHHHHHHcccEEEEcccccEEEEEEEccccccHHHHHHHHHHHccHHHcccEEEEcccccccHHHcc //