[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50458.1
DDBJ      :             dihydrodipicolinate synthase
Swiss-Prot:DAPA_DESRM   RecName: Full=Dihydrodipicolinate synthase;         Short=DHDPS;         EC=4.2.1.52;

Homologs  Archaea  61/68 : Bacteria  859/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->269 1xkyA PDBj 5e-72 50.2 %
:RPS:PDB   1->296 3cprA PDBj 5e-87 39.7 %
:RPS:SCOP  5->289 1f5zA  c.1.10.1 * 8e-90 26.9 %
:HMM:SCOP  3->295 1xkyA1 c.1.10.1 * 2.6e-98 43.8 %
:RPS:PFM   9->282 PF00701 * DHDPS 5e-70 47.6 %
:HMM:PFM   6->292 PF00701 * DHDPS 9.6e-105 48.6 286/289  
:BLT:SWISS 1->296 DAPA_DESRM e-167 100.0 %
:PROS 42->59|PS00665|DHDPS_1
:PROS 137->168|PS00666|DHDPS_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50458.1 GT:GENE ABO50458.1 GT:PRODUCT dihydrodipicolinate synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2130524..2131414) GB:FROM 2130524 GB:TO 2131414 GB:DIRECTION - GB:PRODUCT dihydrodipicolinate synthase GB:NOTE KEGG: chy:CHY_1156 dihydrodipicolinate synthase TIGRFAM: dihydrodipicolinate synthase PFAM: dihydrodipicolinate synthetase GB:PROTEIN_ID ABO50458.1 GB:DB_XREF GI:134052487 InterPro:IPR002220 InterPro:IPR005263 LENGTH 296 SQ:AASEQ MSTVDFGRVITAMVTPFHPDMSVNYTQAKKLSRYLVENGSDGLVVSGTTGESPTLNKDEKIQLFKAVVEEVGGQATVIAGTGSYDTASSIILTKEAEKVGCDGVMLVAPYYNKPSQEGLYQHFRTIAECTSLPVMLYNIPGRTGINVLPATVERLAKDVPNIVAIKEAAGDINQVSELRRILPEDFIIFSGDDSLTLPMLSLGCKGIVSVAAHIAGKQIQEMIDAFTSGNTTLAANLHKELFPIFKGLFITSNPVPVKAALNLKGLAVGGVRLPLVEATAKEIETVKNIMNNLHLL GT:EXON 1|1-296:0| SW:ID DAPA_DESRM SW:DE RecName: Full=Dihydrodipicolinate synthase; Short=DHDPS; EC=4.2.1.52; SW:GN Name=dapA; OrderedLocusNames=Dred_1939; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Diaminopimelate biosynthesis; Lyase; Lysine biosynthesis; Schiff base. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->296|DAPA_DESRM|e-167|100.0|296/296| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 42->59|PS00665|DHDPS_1|PDOC00569| PROS 137->168|PS00666|DHDPS_2|PDOC00569| BL:PDB:NREP 1 BL:PDB:REP 4->269|1xkyA|5e-72|50.2|265/292| RP:PDB:NREP 1 RP:PDB:REP 1->296|3cprA|5e-87|39.7|292/301| RP:PFM:NREP 1 RP:PFM:REP 9->282|PF00701|5e-70|47.6|273/288|DHDPS| HM:PFM:NREP 1 HM:PFM:REP 6->292|PF00701|9.6e-105|48.6|286/289|DHDPS| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00701|IPR002220| GO:PFM GO:0016829|"GO:lyase activity"|PF00701|IPR002220| RP:SCP:NREP 1 RP:SCP:REP 5->289|1f5zA|8e-90|26.9|283/293|c.1.10.1| HM:SCP:REP 3->295|1xkyA1|2.6e-98|43.8|292/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 2307 OP:NHOMOORG 1067 OP:PATTERN 111---224444444221121111211122211111111111111111111111111-1122222--- 3251423133312122211-15112311111254543497111114211331252214--1122315765311112112221311111342312111111211122132511111111111111111111111111111111111111111111111111111111111111111111111113--111112122222222222222227244322221332421111111241222222222222222112211--11-1-1-3311121211111111111111211333333332331111111111111211111111212124111111121235111222111--113112211111122211211121411111111111C661234443122222222224-22522D146511B775AC6CBA66642122435144124111111112231121311-11111111111111111111111111212112454357BB6A673332557544443684722551256421422537487121121221111111111111111111111211111211111111111113111111212211211111111111111111222211211312111111211112121122--1111111111142523314224443422-22422332222542232221434323332323233333232234222222211222222222222111111111121111325222222222222222553542212121443544352465214331----1---122322222212123112323322211111112111111----------1--------1--------1---1---1111112111112 ------1--------22656655685533111122311111112222365AACB98623322-15-------533--------------423222132211-1311--5-3212224111112-2226-9B2-536222-2-2211111-2--21322422214312--21--211111J1111232135311241124 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 100.0 SQ:SECSTR TTHHHHccEEEEccccccTTccccHHHHHHHHHHHHHTTccEEEEccTTTTTTTccHHHHHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEcHHHHcccccHHHHHHHTHTcTTEEEEEEccccHHHHHHHHHHHHHccEEEEccGGGHHHHHHTTccEEEEcGGGTcHHHHHHHHHHHHHTcHHHHHHHHHHTHHHHHHHHHHcHHHHHHHHHHHTTcccccccTTcccccHHHHHHHHHHHHHTTcc DISOP:02AL 1-3| PSIPRED ccccccccEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccc //