[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50467.1
DDBJ      :             polysaccharide deacetylase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  358/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->233 2c1iA PDBj 1e-25 33.2 %
:RPS:PDB   63->234 2cc0B PDBj 3e-35 25.7 %
:RPS:SCOP  37->232 1ny1A  c.6.2.3 * 5e-49 29.1 %
:HMM:SCOP  38->243 2iw0A1 c.6.2.3 * 3.1e-56 37.1 %
:RPS:PFM   67->167 PF01522 * Polysacc_deac_1 1e-16 36.6 %
:HMM:PFM   63->167 PF01522 * Polysacc_deac_1 4.1e-27 31.4 105/124  
:HMM:PFM   192->233 PF04748 * Polysacc_deac_2 1.5e-07 33.3 42/213  
:HMM:PFM   4->87 PF09922 * DUF2154 8e-06 25.6 82/233  
:BLT:SWISS 42->234 YLXY_BACSU 5e-47 41.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50467.1 GT:GENE ABO50467.1 GT:PRODUCT polysaccharide deacetylase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2138499..2139248) GB:FROM 2138499 GB:TO 2139248 GB:DIRECTION - GB:PRODUCT polysaccharide deacetylase GB:NOTE PFAM: polysaccharide deacetylase KEGG: tte:TTE1386 predicted xylanase/chitin deacetylase GB:PROTEIN_ID ABO50467.1 GB:DB_XREF GI:134052496 InterPro:IPR002509 LENGTH 249 SQ:AASEQ MRILFIRRGWLYKTVLWLLIVLFLIGLGVLATNEKHERVFAPIYQGSDKEKKIALACNVFWGEEYIPKMLEIFEDENIKITFFAGGTWVEDFPELLKKMDGAGHEIGSHGYSHPHPDRLSKNGNISDMQRAEKLIYDAIHKRPKLYAPPYGEKGPAVLKAAQEQGYSFILWSIDTIDWQRPAPAIIKQRVVSKAHNGAIVLMHPTDPTVKALPEMIKQLKSEGFEFVKVGEIIEGIPQNVESEKRKTYK GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 42->234|YLXY_BACSU|5e-47|41.5|193/319| TM:NTM 1 TM:REGION 9->31| SEG 15->30|vlwllivlfliglgvl| BL:PDB:NREP 1 BL:PDB:REP 44->233|2c1iA|1e-25|33.2|187/383| RP:PDB:NREP 1 RP:PDB:REP 63->234|2cc0B|3e-35|25.7|171/192| RP:PFM:NREP 1 RP:PFM:REP 67->167|PF01522|1e-16|36.6|101/123|Polysacc_deac_1| HM:PFM:NREP 3 HM:PFM:REP 63->167|PF01522|4.1e-27|31.4|105/124|Polysacc_deac_1| HM:PFM:REP 192->233|PF04748|1.5e-07|33.3|42/213|Polysacc_deac_2| HM:PFM:REP 4->87|PF09922|8e-06|25.6|82/233|DUF2154| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 37->232|1ny1A|5e-49|29.1|196/235|c.6.2.3| HM:SCP:REP 38->243|2iw0A1|3.1e-56|37.1|205/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 1138 OP:NHOMOORG 452 OP:PATTERN --------------------------------------------------22-------1-------- 232-711-------11111-11111211111112221-1-1232-1---11-221-1---342112-6753-222----2112-----1112-111----1222-121-1----------------------1---12222111--221111-22--------1-113352------------242--1--555989899AA8999AC865558599B54676241111129B--------------------1-1--------------1-----11211111111--11111111111111111111111111----111124667666656655438663444433--61152445533353322321--2--1----------32122323332--------------1--2---1--11111112111122----1-1-11-1--------------2--11-----------------------1111--21-1------11--1--------1-----------------------1---111----------------11---2-------1--111-----------1---1-1---------1-1-1111-11------------11-1--------------------1----------------------------------------------------------1111111111111111-----------11111111111--------------------------------------------1-----1-2------111------------------------11222222222222---------------------------------------------------1--1-1-1 ------------CC7244342221412221111414-22222211132347666577222221111111111111112--111111---33246722223351K8J---------------------------------------------------------------------------------1-6-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 84.3 SQ:SECSTR #####################################cccTTcccccTcccEEEEEEEcccccTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcccHHHHHHHHHTTcEEccccEEccGGGTccHHHHcHHHHHTccTTcEEEEEcccHHHHHHHHHHHHHHHTTEEEcEEcTTTcGGccTTcEEcccc## DISOP:02AL 243-246,248-250| PSIPRED cEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccEEcccccccEEEEEEccccccccHHHHHHHHHHccccEEEEEEccHHHccHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHcccEEEEHHHHccccccccccccccccc //