[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50476.1
DDBJ      :             LSU ribosomal protein L7AE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.3
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->103 1t0kB PDBj 3e-05 36.8 %
:RPS:PDB   4->99 2bo1A PDBj 3e-09 25.0 %
:RPS:SCOP  8->92 1h7mA  d.79.3.1 * 1e-08 28.2 %
:HMM:SCOP  4->98 1t0kB_ d.79.3.1 * 4.1e-20 42.1 %
:RPS:PFM   8->88 PF01248 * Ribosomal_L7Ae 3e-06 44.4 %
:HMM:PFM   8->90 PF01248 * Ribosomal_L7Ae 5.5e-12 32.5 83/95  
:BLT:SWISS 6->99 YLXQ_BACSU 6e-10 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50476.1 GT:GENE ABO50476.1 GT:PRODUCT LSU ribosomal protein L7AE GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2149926..2150237) GB:FROM 2149926 GB:TO 2150237 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L7AE GB:NOTE PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45 KEGG: sth:STH1521 L7AE family 50S ribosomal protein GB:PROTEIN_ID ABO50476.1 GB:DB_XREF GI:134052505 InterPro:IPR004038 LENGTH 103 SQ:AASEQ MSGSVFHLLGLSQRAGKTVSGDFAVRENIIKGKVKLLIIAADTSERIKQEYIRIGQSKKVTTKIAFTKHELGSALGKSPRAAVAIMDPNFARGIESLLEGGEA GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 6->99|YLXQ_BACSU|6e-10|35.1|94/100| BL:PDB:NREP 1 BL:PDB:REP 4->103|1t0kB|3e-05|36.8|87/97| RP:PDB:NREP 1 RP:PDB:REP 4->99|2bo1A|3e-09|25.0|96/101| RP:PFM:NREP 1 RP:PFM:REP 8->88|PF01248|3e-06|44.4|81/93|Ribosomal_L7Ae| HM:PFM:NREP 1 HM:PFM:REP 8->90|PF01248|5.5e-12|32.5|83/95|Ribosomal_L7Ae| RP:SCP:NREP 1 RP:SCP:REP 8->92|1h7mA|1e-08|28.2|85/97|d.79.3.1| HM:SCP:REP 4->98|1t0kB_|4.1e-20|42.1|95/0|d.79.3.1|1/1|L30e-like| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------111---111111-11111111111111111111-1--------------11----------------1---------------------------11---111---1-------------1------1-1--1111111-11----1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 100.0 SQ:SECSTR HHHcHHHHHHHHHHHcEEEEcHHHHHHHHHTTcccEEEEETTccHHHHHHHHHHHHHTccEEEEcccHHHHHHHTTcccccEEEEEEcTTccGGGGGcccccc DISOP:02AL 1-1,101-104| PSIPRED ccHHHHHHHHHHHHHccEEccHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccc //