[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50481.1
DDBJ      :             polysaccharide deacetylase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  339/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:263 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->262 2j13A PDBj 8e-51 50.0 %
:RPS:PDB   78->256 2cc0A PDBj 2e-36 28.6 %
:RPS:SCOP  37->262 1ny1A  c.6.2.3 * 1e-58 40.3 %
:HMM:SCOP  67->262 1ny1A_ c.6.2.3 * 3.2e-56 39.8 %
:RPS:PFM   78->193 PF01522 * Polysacc_deac_1 1e-20 39.1 %
:HMM:PFM   76->195 PF01522 * Polysacc_deac_1 5e-35 37.0 119/124  
:BLT:SWISS 38->262 YFUM2_BACST 3e-58 48.2 %
:PROS 70->82|PS00109|PROTEIN_KINASE_TYR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50481.1 GT:GENE ABO50481.1 GT:PRODUCT polysaccharide deacetylase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2153688..2154479) GB:FROM 2153688 GB:TO 2154479 GB:DIRECTION - GB:PRODUCT polysaccharide deacetylase GB:NOTE PFAM: polysaccharide deacetylase KEGG: tte:TTE2006 predicted xylanase/chitin deacetylase GB:PROTEIN_ID ABO50481.1 GB:DB_XREF GI:134052510 InterPro:IPR002509 InterPro:IPR008266 LENGTH 263 SQ:AASEQ MDDKENKKTVEKDTNQDKHQSTVKPQKPKEVVSSTYANEKMGWYYKPNKEHQLPEVNNRGKESLAKYRGIYHGDISGKNLYLTFDEGYENGYTSKILDTLRDANVKVTFFITGDYLRRNPELVKRMVREGHIVGNHTDNHPSLPTVSDATLQKEINSLSDAFTKETGATMQYLRPPMGEYSERTLKLTYEMGYRNVFWSVAMVDWRPDAGTPEQNKNTVKERLHNGAVILLHAVNKANADMLGSLIQECRDEGYRFCGLEEIQ GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 38->262|YFUM2_BACST|3e-58|48.2|224/265| PROS 70->82|PS00109|PROTEIN_KINASE_TYR|PDOC00100| BL:PDB:NREP 1 BL:PDB:REP 64->262|2j13A|8e-51|50.0|182/207| RP:PDB:NREP 1 RP:PDB:REP 78->256|2cc0A|2e-36|28.6|175/192| RP:PFM:NREP 1 RP:PFM:REP 78->193|PF01522|1e-20|39.1|115/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 76->195|PF01522|5e-35|37.0|119/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 37->262|1ny1A|1e-58|40.3|226/235|c.6.2.3| HM:SCP:REP 67->262|1ny1A_|3.2e-56|39.8|196/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 1209 OP:NHOMOORG 432 OP:PATTERN --------------------------------------------------11-------1-------- 232-611-------21111-11221111111111111-1-1222-1--1---121-----2232-1-7863-222----2121---111112-111----1222-222-1---------------------11---12222111-1222111-22--------1-113352------------142--11-556A9A9AABB8AAABC9656695AAC54675241111129A--------------------2-1--------------1-----1121111111111111111111111111111111111111---11112467B66666656654A885555633-162252446533342322321-12--1--------115211-213332--------------1--2---11-111-2211221152----1------1--------------2---------------------------1111--11-1-----1221121------12------11-11----1111-----111--1-11--------------1--12-------1--111--1------------1------1--------------------11------1----------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------22122221112222-------------------------1-------------------------1-1111-1 ------------GH8135441123432--11--5252212222-1-4324764686823234111111111111122212111111---2-33D632222292NEU1--------------------------------------------------------------------------------1-5-1--11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 99.6 SQ:SECSTR #TcGGGGcccHHHHHHHHHHHHHHccGGGccEEEETTEEEEccEEEEGGGGGGGccGGGccHHHHHTTcccccTcccEEEEEEEEccccTTHHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcccHHHHHHHHHTTcEEccccEEccGGGTcTcccHHHHHHHHHTccTTcEEEEEcccHHHHHHHHHHHHHHHHTTEEEcEEEEEE DISOP:02AL 1-53,263-264| PSIPRED ccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcccEEEEHHHcc //