[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50500.1
DDBJ      :             tyrosine recombinase XerC subunit
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  835/915 : Eukaryota  2/199 : Viruses  10/175   --->[See Alignment]
a.60.9d.163.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->292 1a0pA PDBj 3e-37 35.4 %
:RPS:PDB   4->292 2crxA PDBj 2e-39 15.2 %
:RPS:SCOP  4->114 1crxA1  a.60.9.1 * 5e-18 16.2 %
:RPS:SCOP  110->298 1aihA  d.163.1.1 * 4e-35 23.5 %
:HMM:SCOP  4->103 1a0pA1 a.60.9.1 * 7.4e-12 24.5 %
:HMM:SCOP  109->296 4crxA2 d.163.1.1 * 3.7e-60 47.8 %
:RPS:PFM   8->89 PF02899 * Phage_integr_N 2e-10 39.0 %
:RPS:PFM   120->283 PF00589 * Phage_integrase 4e-36 48.7 %
:HMM:PFM   114->285 PF00589 * Phage_integrase 3.5e-51 43.8 169/173  
:HMM:PFM   5->92 PF02899 * Phage_integr_N 3.7e-19 37.3 83/84  
:BLT:SWISS 1->298 XERC_PELTS 1e-85 52.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50500.1 GT:GENE ABO50500.1 GT:PRODUCT tyrosine recombinase XerC subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2175734..2176630) GB:FROM 2175734 GB:TO 2176630 GB:DIRECTION - GB:PRODUCT tyrosine recombinase XerC subunit GB:NOTE TIGRFAM: tyrosine recombinase XerC PFAM: phage integrase family protein; phage integrase domain protein SAM domain protein KEGG: sth:STH1821 recombinase GB:PROTEIN_ID ABO50500.1 GB:DB_XREF GI:134052529 InterPro:IPR002104 InterPro:IPR004107 InterPro:IPR011931 LENGTH 298 SQ:AASEQ MYVLIDNFVNYLKVQKNFSIHTIEAYQKDLFDGLDYFSIVLNKPIEKMDHASINSSLVREFLAYLRQKNLSRATVARKLASWRAFFKFLYNERLAYTNPMLRVANPKREKRLPKFLYQEETKQLVEAPDHSPLGIRDRALLELLYATGIRVSELVALDLSNIDLARGYIRVMGKGSKERVVPFHQSAVAAMKEYCRNARPKMVIKDCEAVFVNYKGTRLSDRGIRKIVDKYCQRLGMKLNVSPHTIRHSFATHLLDNGADLRSVQELLGHVSLSTTQIYTHVTKKKIKRVYKMSHPRA GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 1->298|XERC_PELTS|1e-85|52.0|298/306| BL:PDB:NREP 1 BL:PDB:REP 5->292|1a0pA|3e-37|35.4|263/271| RP:PDB:NREP 1 RP:PDB:REP 4->292|2crxA|2e-39|15.2|283/305| RP:PFM:NREP 2 RP:PFM:REP 8->89|PF02899|2e-10|39.0|77/84|Phage_integr_N| RP:PFM:REP 120->283|PF00589|4e-36|48.7|158/168|Phage_integrase| HM:PFM:NREP 2 HM:PFM:REP 114->285|PF00589|3.5e-51|43.8|169/173|Phage_integrase| HM:PFM:REP 5->92|PF02899|3.7e-19|37.3|83/84|Phage_integr_N| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF02899|IPR004107| GO:PFM GO:0015074|"GO:DNA integration"|PF02899|IPR004107| GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 2 RP:SCP:REP 4->114|1crxA1|5e-18|16.2|105/110|a.60.9.1| RP:SCP:REP 110->298|1aihA|4e-35|23.5|166/170|d.163.1.1| HM:SCP:REP 4->103|1a0pA1|7.4e-12|24.5|94/0|a.60.9.1|1/1|lambda integrase-like, N-terminal domain| HM:SCP:REP 109->296|4crxA2|3.7e-60|47.8|186/212|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 2807 OP:NHOMOORG 890 OP:PATTERN --1-1111111111112-------------1-1111111548311111--41--1111111212---- 23J2422222222223622-252232222222C52864C62256122322224242422255824351--3222232242222--111778525322--52B39342342222222222222222232443222321111124662E58211-11-1------4--243F1------------24212233332343442563466347323322245968A2542222334342222322223322224322333333324343244224522224363111111121322336235442233222221122122212412269434543465557243552322334132187654AA471944223432233EC22222222223223222323222222223222-322234232M23222722IE22772232292422223323333333392222323222222222226222222222222222221253622222A34425332222655H32422337423I7224537543323733222933322-2222222434K33227512255I5642622373255633423343132111111111112111123121297262482123343366344423352424434--25333------43452334447455725-522574446255544343257583DH43224262343253435742244422-322222222322--12------2--232223322222222122223333422222233343333323333357722222222233347333433334422233333332222--33442333--------522---------1--------2-1-33211111121112A2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1---------- ---------------1------1--------1------------------1---------------------------------1--1------------1------1-----------------1---------------1--------------------------------- STR:NPRED 293 STR:RPRED 98.3 SQ:SECSTR ###HHHHHHHHHHTGGGccHHHHHHHHHHHHHHHHHHHH##HTccTTccTTTTcHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHTTTcccGGGcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHcccHHHHHHcccccEEEEETTEEEEccccEEccHHHHHHHHHHHHTTTcTTcccccEEETTTEEEccccccccHHHHHHHHHHHHHHHHccccccTTHHHHHHHHHHHHccccGGGGHHHHTcccHHHHHHHHTTccTTccHHHHHGGTTT DISOP:02AL 297-299| PSIPRED cHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHcccHHHccccccEEEEEcccccEEEEEccHHHHHHHHHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcccc //