[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50517.1
DDBJ      :             CBS domain containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->146 2ef7A PDBj 4e-07 19.0 %
:RPS:SCOP  1->148 2v8qE2  d.37.1.1 * 2e-08 18.2 %
:HMM:SCOP  79->145 2nycA1 d.37.1.1 * 1.5e-06 21.2 %
:HMM:PFM   6->62 PF00571 * CBS 3.5e-07 29.8 47/57  
:HMM:PFM   89->144 PF00571 * CBS 3.7e-07 21.8 55/57  
:BLT:SWISS 5->152 Y1004_METJA 1e-04 26.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50517.1 GT:GENE ABO50517.1 GT:PRODUCT CBS domain containing protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2196610..2197068) GB:FROM 2196610 GB:TO 2197068 GB:DIRECTION - GB:PRODUCT CBS domain containing protein GB:NOTE PFAM: CBS domain containing protein GB:PROTEIN_ID ABO50517.1 GB:DB_XREF GI:134052546 InterPro:IPR000644 LENGTH 152 SQ:AASEQ MVPIQDYATVFLENTLRDAMFVLKNTFYSGHMAGSQAHRSVLVFDNKKQLVGTLSFRDIITSLQMYCDGPQHWEGLFARICLNQAGKKVKDIMRPVEKERLQAEDSILDAIYMLTSKGLELVPVEENGNIIGMVRPVEIFKEVSELVEANVF GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 5->152|Y1004_METJA|1e-04|26.7|120/214| RP:PDB:NREP 1 RP:PDB:REP 1->146|2ef7A|4e-07|19.0|116/121| HM:PFM:NREP 2 HM:PFM:REP 6->62|PF00571|3.5e-07|29.8|47/57|CBS| HM:PFM:REP 89->144|PF00571|3.7e-07|21.8|55/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 1->148|2v8qE2|2e-08|18.2|137/159|d.37.1.1| HM:SCP:REP 79->145|2nycA1|1.5e-06|21.2|66/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 13 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------351-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 94.1 SQ:SECSTR GGTcccccEEETTccHHHHHHHHHHccccEEE###HTccEEEEEETTEcEEEEEEHHHHHHHHHTcccccHHHHHHHHHHHTTccTTccGGGTEETccccEETTccHHHHHHHHHHTccEEEEEcTTccEEEEEEHHHHHHHHHHc###### DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccEEEEEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEcHHHHHHHHHHHHHcccc //