[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50530.1
DDBJ      :             AAA ATPase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  183/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
c.37.1
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   122->250 3eccA PDBj 1e-12 32.8 %
:RPS:PDB   98->263 3eccA PDBj 7e-06 21.1 %
:RPS:SCOP  101->270 1l8qA2  c.37.1.20 * 1e-08 19.0 %
:HMM:SCOP  68->258 1l8qA2 c.37.1.20 * 1.2e-15 22.1 %
:RPS:PFM   108->229 PF01695 * IstB 5e-20 49.1 %
:HMM:PFM   121->232 PF01695 * IstB 7.5e-19 30.2 106/178  
:HMM:PFM   87->138 PF03969 * AFG1_ATPase 0.00043 25.5 51/362  
:HMM:PFM   15->78 PF04798 * Baculo_19 0.00069 17.7 62/146  
:BLT:SWISS 7->252 YQAM_BACSU 2e-14 30.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50530.1 GT:GENE ABO50530.1 GT:PRODUCT AAA ATPase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2212100..2212951) GB:FROM 2212100 GB:TO 2212951 GB:DIRECTION - GB:PRODUCT AAA ATPase GB:NOTE SMART: AAA ATPase KEGG: mta:Moth_1184 IstB-like ATP-binding protein GB:PROTEIN_ID ABO50530.1 GB:DB_XREF GI:134052559 InterPro:IPR003593 LENGTH 283 SQ:AASEQ MDYFNPEKVIKDLKARNKETPSKEKRITKFECNKCQDRGIYMEGEFAVPCQCVKRRSLENKFKNCQIPKSMLKHSFNNFDFRYYSSSLKEPLSKRTYLEIAQKTYLFAQEFARDFIKGKVTEGLLIQGPVGSGKTFLACCIVNQVLRNSDKEVLFVIVPDLLEKIKASYSNAAGGYSEYTLVEAACEIPLLVMDDLGAHSYTEWTKNKLYNIINYRVNHELPTIITTNLILAGDLTNLIGERTVSRIEQMCRPLWLERERDIREVLREEKAGQIRHSSFFEKI GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 7->252|YQAM_BACSU|2e-14|30.9|223/313| BL:PDB:NREP 1 BL:PDB:REP 122->250|3eccA|1e-12|32.8|125/182| RP:PDB:NREP 1 RP:PDB:REP 98->263|3eccA|7e-06|21.1|161/182| RP:PFM:NREP 1 RP:PFM:REP 108->229|PF01695|5e-20|49.1|114/145|IstB| HM:PFM:NREP 3 HM:PFM:REP 121->232|PF01695|7.5e-19|30.2|106/178|IstB| HM:PFM:REP 87->138|PF03969|0.00043|25.5|51/362|AFG1_ATPase| HM:PFM:REP 15->78|PF04798|0.00069|17.7|62/146|Baculo_19| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01695|IPR002611| RP:SCP:NREP 1 RP:SCP:REP 101->270|1l8qA2|1e-08|19.0|163/213|c.37.1.20| HM:SCP:REP 68->258|1l8qA2|1.2e-15|22.1|163/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 267 OP:NHOMOORG 192 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------------------------12-111211------------------------------------------------1111111131----------------------------------------------114444411211211211233121131111-11111111112211111111112111111111--11--111--1111-1--1-2-1---3-11--------11---11211121121122---------1231142323433-5-12111111-12121241111221-1-211111-------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111---------------------------------------------------------------1--1---1----------------------------------------11----1---------------------------------------------------------------------------------------1-----1112----------------------------------------------111111----------1---------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1-------------------------1-----------------------------------------11------------------1--1-------------1----1--1---------------------------------------------- STR:NPRED 176 STR:RPRED 62.2 SQ:SECSTR ##############################################################################################cccccHHHHHHHHHHHHHHHTccTTcccEEEEEEcTTccHHHHHHHHHHHHHHHHTccccEEEEHHHHHHHHHHHHHHHTTccccHHHHHHHTcccEEEETTTcccccHHHHHHHHHHHHHHHHTTccEEEEEEccccccccHHHHHHHHHHcHHHcHHHHHHHEEEEEHHccccH############# DISOP:02AL 1-1,17-21,23-24,263-279,282-284| PSIPRED cccccHHHHHHHHHHHHHcccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHcccHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHcEEEEcccHHHHHHHHHHHHccccccccccccc //