[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50539.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  138/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->88 PF09350 * DUF1992 5e-12 48.8 %
:HMM:PFM   7->75 PF09350 * DUF1992 6.3e-26 46.4 69/71  
:BLT:SWISS 1->120 YFLB_BACSU 2e-27 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50539.1 GT:GENE ABO50539.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2226074..2226448 GB:FROM 2226074 GB:TO 2226448 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_1753 hypothetical protein GB:PROTEIN_ID ABO50539.1 GB:DB_XREF GI:134052568 LENGTH 124 SQ:AASEQ MDLFTMLAENKIREAMEKGELNNLPGSGQPLELDDMSHIPEDLRAGYRLLKNAGVIPEEMELKKEIISLQKLIDYCYDEKDRTHLIKKLNEKILRFNILMEKRKVVSPALSFYKEKIYARFQGY GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 1->120|YFLB_BACSU|2e-27|45.8|120/130| RP:PFM:NREP 1 RP:PFM:REP 7->88|PF09350|5e-12|48.8|82/92|DUF1992| HM:PFM:NREP 1 HM:PFM:REP 7->75|PF09350|6.3e-26|46.4|69/71|DUF1992| OP:NHOMO 143 OP:NHOMOORG 138 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------11----1-----------------------------------------------1111111111111121-11111122111-1---------1----------------------------------------------------------------------------------------------------------------------------12111-11---------2----------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-------------------------------------------111-1-11-1111------11---------1-------------------------------------------------------------11-------11-1--11111111111-1111111111111111111111-1--11111111111111111-111---1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccc //