[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50543.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->72 PF09932 * DUF2164 4e-10 38.2 %
:HMM:PFM   5->72 PF09932 * DUF2164 4.6e-26 39.7 68/76  
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50543.1 GT:GENE ABO50543.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2229802..2230053 GB:FROM 2229802 GB:TO 2230053 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dsy:DSY0345 hypothetical protein GB:PROTEIN_ID ABO50543.1 GB:DB_XREF GI:134052572 LENGTH 83 SQ:AASEQ MREIIKLDKETRQYMISEIKTYFLIERDEDLGDLASGLILDFFIEKLASEFYNQGVYDSYSYMSDKIVDLLEIQKSNNISPKR GT:EXON 1|1-83:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| RP:PFM:NREP 1 RP:PFM:REP 5->72|PF09932|4e-10|38.2|68/76|DUF2164| HM:PFM:NREP 1 HM:PFM:REP 5->72|PF09932|4.6e-26|39.7|68/76|DUF2164| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN --------------------------------------------1----------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1---11--------------11-1-------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,78-84| PSIPRED ccHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //