Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50548.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50548.1 GT:GENE ABO50548.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2232761..2233114) GB:FROM 2232761 GB:TO 2233114 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50548.1 GB:DB_XREF GI:134052577 LENGTH 117 SQ:AASEQ MPKYAVEGVENMNIKGTLKSFGIYLNGLIDKGYVEDIGVIEKEMAQENIAHYLAAKYEREIPLNDINDIDKAEVNRLYASWSGYIEGFECRRFFVKKNGLILLSSLCMELLYDQDLD GT:EXON 1|1-117:0| SEG 100->111|lillsslcmell| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,117-118| PSIPRED cccHHHccccccccEEEHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHEEEEccccHHHHHHHHHHHHHHcccc //