[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50552.1
DDBJ      :             protein of unknown function UPF0102
Swiss-Prot:Y2035_DESRM  RecName: Full=UPF0102 protein Dred_2035;

Homologs  Archaea  0/68 : Bacteria  277/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->102 3fovA PDBj 1e-06 32.5 %
:RPS:SCOP  10->121 2inbA1  c.52.1.32 * 1e-18 12.0 %
:HMM:SCOP  10->114 1hh1A_ c.52.1.18 * 1.4e-20 40.4 %
:RPS:PFM   12->104 PF02021 * UPF0102 5e-18 45.1 %
:HMM:PFM   11->104 PF02021 * UPF0102 1.2e-28 39.1 92/93  
:BLT:SWISS 1->122 Y2035_DESRM 6e-68 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50552.1 GT:GENE ABO50552.1 GT:PRODUCT protein of unknown function UPF0102 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2235129..2235497) GB:FROM 2235129 GB:TO 2235497 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0102 GB:NOTE PFAM: protein of unknown function UPF0102 KEGG: tte:TTE1452 predicted endonuclease distantly related to archaeal Holliday junction resolvase GB:PROTEIN_ID ABO50552.1 GB:DB_XREF GI:134052581 InterPro:IPR003509 LENGTH 122 SQ:AASEQ MSIQRKALGNKGEEEACKYIQNLGYNIMERNYRCKIGELDIIAWDPVGMLVFLEVRSRSGRAFGVPEESVNYRKQNKLRMLAQQFLLTKSEFAKISCRFDVIGVYFNKEGSVQEIKHIKNAL GT:EXON 1|1-122:0| SW:ID Y2035_DESRM SW:DE RecName: Full=UPF0102 protein Dred_2035; SW:GN OrderedLocusNames=Dred_2035; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|Y2035_DESRM|6e-68|100.0|122/122| BL:PDB:NREP 1 BL:PDB:REP 13->102|3fovA|1e-06|32.5|80/101| RP:PFM:NREP 1 RP:PFM:REP 12->104|PF02021|5e-18|45.1|91/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 11->104|PF02021|1.2e-28|39.1|92/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 10->121|2inbA1|1e-18|12.0|108/128|c.52.1.32| HM:SCP:REP 10->114|1hh1A_|1.4e-20|40.4|99/0|c.52.1.18|1/1|Restriction endonuclease-like| OP:NHOMO 279 OP:NHOMOORG 277 OP:PATTERN -------------------------------------------------------------------- -11--111---1-11--11-1----111111-1111111111111-1-11111-1-11111--1111-11111111111111--1111------111---1111-11111---------------1111-11-11-1111111111-------1----------11-----------------1-1--111----------------------------------------11------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111-1--1-----------------------------------------------------------------------------------------------------------------------------------1111---------1---------11----111-1------1--11--111111111111211--1-1111111--1---1111111111----1-12-------------------------11--1-11--1-1----------------------1--1-------------------------------------------------------------------1------------------------1111-1-111111--111---1--------------11111111111-1-11111111111-1-11-1-111------11-1111--------1111--11--------------1--------------------------------111-1--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 78.7 SQ:SECSTR #####HHHHHccHHHHHHHHHHTTcEEEEEEEEETTEEEEEEEcEETTEEEEEEEEEcc#HHTccccccccHHHHHHHHHHHHHHHHHcGGGTcTEEEEEEE#################### DISOP:02AL 1-6,8-8| PSIPRED ccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEEEEcccEEEEEEEEEEcccccccHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccccccccEEEcccc //