[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50556.1
DDBJ      :             NADH-ubiquinone oxidoreductase, chain 4L
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->105 PF00420 * Oxidored_q2 3.7e-24 30.8 91/95  
:BLT:SWISS 29->105 NU4LC_PAUCH 1e-10 49.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50556.1 GT:GENE ABO50556.1 GT:PRODUCT NADH-ubiquinone oxidoreductase, chain 4L GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2240550..2240867) GB:FROM 2240550 GB:TO 2240867 GB:DIRECTION - GB:PRODUCT NADH-ubiquinone oxidoreductase, chain 4L GB:NOTE PFAM: NADH-ubiquinone oxidoreductase, chain 4L KEGG: chy:CHY_1418 proton-translocating NADH-quinone oxidoreductase, K subunit GB:PROTEIN_ID ABO50556.1 GB:DB_XREF GI:134052585 InterPro:IPR001133 InterPro:IPR003214 InterPro:IPR003215 LENGTH 105 SQ:AASEQ MGTGLNPSYFIGLSAALFAIGAFGAISKKNAIAVLISIELMLSAVNINLVAINKFLTPEAFIGQIFAIFVITVAAAEVGLGLAIVIAIFRNRHSVNLDDFDLMKW GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 29->105|NU4LC_PAUCH|1e-10|49.4|77/103| TM:NTM 3 TM:REGION 6->27| TM:REGION 31->53| TM:REGION 64->86| SEG 11->27|iglsaalfaigafgais| SEG 65->76|ifaifvitvaaa| HM:PFM:NREP 1 HM:PFM:REP 13->105|PF00420|3.7e-24|30.8|91/95|Oxidored_q2| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------------------------------------------------------------------------------111------111-------11---------------------------------------------------------------------1-----------------------------------------------------------------------------------------------1--------------------------1---11-----1--------------------------------------------------------------------------------------------------1----------------------------------------------------------------111---11111----1-------11-1------------11--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcc //