[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50561.1
DDBJ      :             NADH (or F420H2) dehydrogenase, subunit C
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  579/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
d.307.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->140 3i9v5 PDBj 3e-22 42.5 %
:RPS:PDB   1->140 2c6zA PDBj 1e-14 12.9 %
:RPS:SCOP  6->144 2fug51  d.307.1.1 * 2e-28 39.1 %
:HMM:SCOP  7->148 2fug51 d.307.1.1 * 1.6e-40 41.8 %
:RPS:PFM   47->138 PF00329 * Complex1_30kDa 8e-24 55.4 %
:HMM:PFM   39->138 PF00329 * Complex1_30kDa 1.6e-37 51.5 99/103  
:BLT:SWISS 10->145 NUOC_MOOTA 1e-31 50.7 %
:PROS 105->126|PS00542|COMPLEX1_30K

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50561.1 GT:GENE ABO50561.1 GT:PRODUCT NADH (or F420H2) dehydrogenase, subunit C GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2244064..2244507) GB:FROM 2244064 GB:TO 2244507 GB:DIRECTION - GB:PRODUCT NADH (or F420H2) dehydrogenase, subunit C GB:NOTE TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C PFAM: NADH dehydrogenase (ubiquinone), 30 kDa subunit KEGG: mta:Moth_0979 NADH (or F420H2) dehydrogenase, subunit C GB:PROTEIN_ID ABO50561.1 GB:DB_XREF GI:134052590 InterPro:IPR001268 InterPro:IPR010218 LENGTH 147 SQ:AASEQ MNGKPLAEIIQELTNKYPSLEVSEKGHLTVPVESLMLFMRDLKEIYGFNYLTNVTGADYLEYLEVVYNLCIIGHPEMLHVKTRLDRNNPEVPSMVPIWGGAIWQEREVFDLLGIVFTDHPDLRRILLADDWEGHPLRRDYQWEGGRE GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 10->145|NUOC_MOOTA|1e-31|50.7|136/148| PROS 105->126|PS00542|COMPLEX1_30K|PDOC00468| BL:PDB:NREP 1 BL:PDB:REP 6->140|3i9v5|3e-22|42.5|134/196| RP:PDB:NREP 1 RP:PDB:REP 1->140|2c6zA|1e-14|12.9|132/273| RP:PFM:NREP 1 RP:PFM:REP 47->138|PF00329|8e-24|55.4|92/103|Complex1_30kDa| HM:PFM:NREP 1 HM:PFM:REP 39->138|PF00329|1.6e-37|51.5|99/103|Complex1_30kDa| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00329|IPR001268| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00329|IPR001268| RP:SCP:NREP 1 RP:SCP:REP 6->144|2fug51|2e-28|39.1|133/191|d.307.1.1| HM:SCP:REP 7->148|2fug51|1.6e-40|41.8|141/0|d.307.1.1|1/1|Nqo5-like| OP:NHOMO 919 OP:NHOMOORG 764 OP:PATTERN 111-1111111111111-------21121311-----------------1111-1--2-2-111--11 22212---------11111-11--11111111111111111111-1--1-----------21112112221-----------11222211111---1--1-11--22211--------------1111111111212222211121111111111111111111112111111111111111111111----1-111111111111111------111111----------1-----------------------------------------------------------------------------------------------1-----------------------2--1-1121----12--1----22-111111111111111111111211111111111-11111111111111112221212211111111111111111111111222-11121121111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---12---1-222122213222212-11122111111111111111112-1111111---------------------1----11--211111111111111213332322233-3333322333323333332222111111211111111111112123232211-111111111111-1111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111-------------------------------------1---1----121 ------1-----21111111111111111111111111111111111111111111111111111----1--111------11111---12111111111111111-12-23211111111-1-11121141-2211111111111111111-1112111221211211--2211111--------1131-3------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 95.2 SQ:SECSTR ccccccHHHHHHHHHHHHHHHHTTTccEEEEEccTTTcGGGGEEEEEETTEEEEcccccGGGTTHHHHHHHHHHHTTcEEEEcccTTcccccccTccGGGEEEcccEEEEEEcccHHHHHHHHHHcTTcEEEEEEccccc####### DISOP:02AL 1-2,143-143,146-148| PSIPRED cccccHHHHHHHHHHHccEEEEEEccEEEEEHHHHHHHHHHHHHHccccEEEEEEEEEEcccEEEEEEEEEccccEEEEEEEEEccccccccccHHHcccccHHHHHHHHHccEEEccccccccccccccccccccccccccccccc //