[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50565.1
DDBJ      :             Ras superfamily GTP-binding protein YlqF
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  368/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:284 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   11->282 1pujA PDBj 1e-70 46.5 %
:RPS:PDB   17->73 3cnnA PDBj 3e-07 43.6 %
:RPS:PDB   46->115 3efxD PDBj 1e-04 10.6 %
:RPS:PDB   123->186 3a1tA PDBj 5e-09 30.2 %
:RPS:SCOP  11->282 1pujA  c.37.1.8 * 4e-46 46.5 %
:HMM:SCOP  11->217 1pujA_ c.37.1.8 * 6e-43 30.0 %
:RPS:PFM   134->178 PF01926 * MMR_HSR1 2e-05 42.2 %
:HMM:PFM   134->190 PF01926 * MMR_HSR1 3e-14 35.1 57/108  
:BLT:SWISS 5->284 RBGA_BACSU 4e-83 48.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50565.1 GT:GENE ABO50565.1 GT:PRODUCT Ras superfamily GTP-binding protein YlqF GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2246755..2247609) GB:FROM 2246755 GB:TO 2247609 GB:DIRECTION - GB:PRODUCT Ras superfamily GTP-binding protein YlqF GB:NOTE PFAM: GTP-binding protein, HSR1-related KEGG: gka:GK1204 hypothetical protein GB:PROTEIN_ID ABO50565.1 GB:DB_XREF GI:134052594 InterPro:IPR002917 InterPro:IPR005289 LENGTH 284 SQ:AASEQ MDIQIQWFPGHMAKAKRQVQDALKLVDVAFELLDARIPVSSSNPMIDQILGQKPRVIILNKSDLADPSITKQWQRALDRPYIKAIAVDTIKGEGLKEVPRVASMLVAEQMAKLAAKGRRPRAIRCMVLGIPNVGKSTFINRLVGRKATKTGDTPGVTKGQQWIRTQGSLELLDTPGILWPKFEDPEVGYKLAVTGAIKEQVFDIYEVSLKLLQWLAEYNPEKLKERYRMNELNPEATKLLWDIGVKRGLLVSGGLVDESKVAQLILKEFREGLLGRYTLDLPPM GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 5->284|RBGA_BACSU|4e-83|48.6|280/282| BL:PDB:NREP 1 BL:PDB:REP 11->282|1pujA|1e-70|46.5|260/261| RP:PDB:NREP 3 RP:PDB:REP 17->73|3cnnA|3e-07|43.6|55/227| RP:PDB:REP 46->115|3efxD|1e-04|10.6|66/96| RP:PDB:REP 123->186|3a1tA|5e-09|30.2|63/254| RP:PFM:NREP 1 RP:PFM:REP 134->178|PF01926|2e-05|42.2|45/105|MMR_HSR1| HM:PFM:NREP 1 HM:PFM:REP 134->190|PF01926|3e-14|35.1|57/108|MMR_HSR1| GO:PFM:NREP 2 GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| RP:SCP:NREP 1 RP:SCP:REP 11->282|1pujA|4e-46|46.5|260/261|c.37.1.8| HM:SCP:REP 11->217|1pujA_|6e-43|30.0|207/273|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1137 OP:NHOMOORG 602 OP:PATTERN --111111111111111-11111------------11111111------1111-1111111---1--- -------------------------------------------------------------------------------------111----------------------------------------------------------1111111111111111111111111111111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111-121111-11--1---1-----------------------------------------------------------------------------------------------------------------------------------------------------11-1-----1-1111122111111111111111111---111--1---1--------1-1---111-----1-----------------------------11-1111-1111111111111111111111----------------------------------------------------------------------------------------------------11111-----1-11----------------------111-1-----------------111111111211121111111111------------------------11111111--111111-111111-1111111111111111111111--- 2222553-82314441243233323214434442221444444443333333232323344422334423432443413343333334-23423323211332332-553369554423-233257151KS7-658211253332232336214354455C743533433648432244K3333346954641343332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 100.0 SQ:SECSTR EEEEEEEccccHHcTTHHHHHHHcTTccTTccccccccccTTcccccccccGGHHHHHHHHHHTTcccccHHHHHHHHHTccHHHHHHccHHHHHHHHHHHHHHHHTcccHHHHHHHHTcccEEEEEEccTTccHHHHHHHHHTTcEcEEEEcTTccEEEEEEETTEEEEEEEcccccccccccHHEEGGGcccHHHHHHHHHHHHHHHTccccHHHHHHHHHHHTTccEEEEccHHHHHcGGGcccHHcccTTcccHHHHHHHHHHHHHTTTTcccccccTTc PSIPRED ccccccccHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHccccEEEEEEccccccHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHcccEEEEcccccccccEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHcccccEEEcccccc //