[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50570.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->131 PF11068 * DUF2869 3e-11 40.8 %
:HMM:PFM   2->131 PF11068 * DUF2869 1.4e-42 46.2 130/131  
:BLT:SWISS 92->131 YLQD_BACSU 7e-06 42.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50570.1 GT:GENE ABO50570.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2250058..2250471) GB:FROM 2250058 GB:TO 2250471 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: sth:STH1468 hypothetical protein GB:PROTEIN_ID ABO50570.1 GB:DB_XREF GI:134052599 LENGTH 137 SQ:AASEQ MLTITRPVMVKVRVTDQYKRMLAVEFQQKVTKLELELKQLEFQTGKLMEIAKKNPSAAEAALTQVEQEKQKRLDTRLMLLDKIKDVGKLVNGSEVLQGKVESFVQVQVGDDWNQLMNAEIILEDGKVVEIRALHPEG GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 92->131|YLQD_BACSU|7e-06|42.5|40/100| SEG 27->41|qqkvtklelelkqle| RP:PFM:NREP 1 RP:PFM:REP 2->131|PF11068|3e-11|40.8|130/131|DUF2869| HM:PFM:NREP 1 HM:PFM:REP 2->131|PF11068|1.4e-42|46.2|130/131|DUF2869| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1---1---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,51-52,54-55,135-138| PSIPRED cccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEEEccccHHHHHcccEEEEccEEEEEEEccccc //