[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50574.1
DDBJ      :             putative helix-turn-helix protein, YlxM/p13 family protein
Swiss-Prot:Y2057_DESRM  RecName: Full=UPF0122 protein Dred_2057;

Homologs  Archaea  0/68 : Bacteria  178/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.13
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->85 1s7oC PDBj 4e-18 42.4 %
:RPS:PDB   17->59 1biaA PDBj 8e-06 18.6 %
:RPS:SCOP  18->61 1k78A1  a.4.1.5 * 8e-06 20.5 %
:HMM:SCOP  2->107 1s7oA_ a.4.13.3 * 1.3e-28 46.2 %
:RPS:PFM   6->88 PF04297 * UPF0122 4e-16 59.8 %
:HMM:PFM   4->84 PF04297 * UPF0122 4.5e-31 53.8 80/101  
:BLT:SWISS 1->117 Y2057_DESRM 3e-63 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50574.1 GT:GENE ABO50574.1 GT:PRODUCT putative helix-turn-helix protein, YlxM/p13 family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2252476..2252829) GB:FROM 2252476 GB:TO 2252829 GB:DIRECTION - GB:PRODUCT putative helix-turn-helix protein, YlxM/p13 family protein GB:NOTE PFAM: Bacterio-opsin activator, HTH domain protein; putative helix-turn-helix protein, YlxM/p13 family protein; sigma-70 region 4 domain protein KEGG: bha:BH2485 unknown conserved protein GB:PROTEIN_ID ABO50574.1 GB:DB_XREF GI:134052603 InterPro:IPR007050 InterPro:IPR007394 InterPro:IPR007630 LENGTH 117 SQ:AASEQ MKEFHKINLLNDYYGSLLTERQQNFIELYYGEDLSLGEIAEQYNVTRQAVHDTLKRAEQTLTNYEEKLGLVSKFSQESKSLVEVINLLDGYESGEAPEGLEKSKGILKKILEKRQDL GT:EXON 1|1-117:0| SW:ID Y2057_DESRM SW:DE RecName: Full=UPF0122 protein Dred_2057; SW:GN OrderedLocusNames=Dred_2057; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|Y2057_DESRM|3e-63|100.0|117/117| BL:PDB:NREP 1 BL:PDB:REP 1->85|1s7oC|4e-18|42.4|85/108| RP:PDB:NREP 1 RP:PDB:REP 17->59|1biaA|8e-06|18.6|43/292| RP:PFM:NREP 1 RP:PFM:REP 6->88|PF04297|4e-16|59.8|82/100|UPF0122| HM:PFM:NREP 1 HM:PFM:REP 4->84|PF04297|4.5e-31|53.8|80/101|UPF0122| RP:SCP:NREP 1 RP:SCP:REP 18->61|1k78A1|8e-06|20.5|44/63|a.4.1.5| HM:SCP:REP 2->107|1s7oA_|1.3e-28|46.2|106/0|a.4.13.3|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 178 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-11111111111111111111111111111111111111111111-11111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 79.5 SQ:SECSTR ccccHHHHHHHHHHGGcccHHHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHcccccHHH######################## DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcc //