[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50583.1
DDBJ      :             protein of unknown function DUF1540
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->61 PF07561 * DUF1540 9.3e-22 60.0 40/40  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50583.1 GT:GENE ABO50583.1 GT:PRODUCT protein of unknown function DUF1540 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2262288..2262488) GB:FROM 2262288 GB:TO 2262488 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1540 GB:NOTE PFAM: protein of unknown function DUF1540 KEGG: mta:Moth_0712 protein of unknown function DUF1540 GB:PROTEIN_ID ABO50583.1 GB:DB_XREF GI:134052612 InterPro:IPR011437 LENGTH 66 SQ:AASEQ MPEVACTVSNCKYYKQGNFCTADQIIVQNDAQGGGFGPNAQLSNLAATPANSNDDTCCQTFKNANG GT:EXON 1|1-66:0| HM:PFM:NREP 1 HM:PFM:REP 4->61|PF07561|9.3e-22|60.0|40/40|DUF1540| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-1111-111-------111-------------1-------------------------------------------------------------------------------------------------------------------------------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,35-44,65-67| PSIPRED ccEEEEEEcccEEEcccccccccEEEEEEccccccccccccHHHHHccccccccccHHHHHccccc //