[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50592.1
DDBJ      :             3-oxoacyl-[acyl-carrier-protein] synthase III
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  819/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->330 2ebdB PDBj 8e-80 50.8 %
:RPS:PDB   8->323 1b65A PDBj 1e-49 8.1 %
:RPS:SCOP  8->162 1eblA1  c.95.1.2 * 4e-57 46.5 %
:RPS:SCOP  216->331 1u0mA2  c.95.1.2 * 8e-32 23.3 %
:HMM:SCOP  7->333 1tedA_ c.95.1.2 * 4.8e-73 33.7 %
:RPS:PFM   111->189 PF08545 * ACP_syn_III 2e-15 43.0 %
:RPS:PFM   244->329 PF08541 * ACP_syn_III_C 1e-26 60.5 %
:HMM:PFM   241->330 PF08541 * ACP_syn_III_C 1.2e-39 58.9 90/90  
:HMM:PFM   111->189 PF08545 * ACP_syn_III 5e-34 56.4 78/80  
:BLT:SWISS 6->330 FABH_THETN e-109 62.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50592.1 GT:GENE ABO50592.1 GT:PRODUCT 3-oxoacyl-[acyl-carrier-protein] synthase III GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2272401..2273408) GB:FROM 2272401 GB:TO 2273408 GB:DIRECTION - GB:PRODUCT 3-oxoacyl-[acyl-carrier-protein] synthase III GB:NOTE KEGG: tte:TTE1475 3-oxoacyl-(acyl-carrier-protein) synthase III TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase III PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III GB:PROTEIN_ID ABO50592.1 GB:DB_XREF GI:134052621 InterPro:IPR004655 InterPro:IPR013747 InterPro:IPR013751 LENGTH 335 SQ:AASEQ MPNHLIRAGILGVGSYVPERILTNKELEKIVDTSDEWIKSRTGIKERRIAEPGKSTSDLATIASRRALEHAGIKPEELDLIILTTCSKDMIIPAGACLVQQELGATKAGAFDLEAGCSGFVYGLSIATQFIATGAMKHVLVIGSEVLSKVVNWDDRNTCVLFGDGAGAVVVGPVSSDEGVLASKLSAEGAGWEHLYIPAGGSKMPADPVTVEKKLHYIHMNGKEVFRYAVRVMEEASLTLLKAANLELSDIDLLIPHQANMRIIEHAAKKLRLPMDKVAVNLDRYGNTSSASIPIALAEAVHSGRVKAGDNLVMVAFGAGLTSGGVVLKWRDREG GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 6->330|FABH_THETN|e-109|62.2|325/331| SEG 163->177|gdgagavvvgpvssd| BL:PDB:NREP 1 BL:PDB:REP 10->330|2ebdB|8e-80|50.8|305/308| RP:PDB:NREP 1 RP:PDB:REP 8->323|1b65A|1e-49|8.1|295/363| RP:PFM:NREP 2 RP:PFM:REP 111->189|PF08545|2e-15|43.0|79/79|ACP_syn_III| RP:PFM:REP 244->329|PF08541|1e-26|60.5|86/90|ACP_syn_III_C| HM:PFM:NREP 2 HM:PFM:REP 241->330|PF08541|1.2e-39|58.9|90/90|ACP_syn_III_C| HM:PFM:REP 111->189|PF08545|5e-34|56.4|78/80|ACP_syn_III| GO:PFM:NREP 4 GO:PFM GO:0004315|"GO:3-oxoacyl-[acyl-carrier-protein] synthase activity"|PF08545|IPR013751| GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF08545|IPR013751| GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF08541|IPR013747| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF08541|IPR013747| RP:SCP:NREP 2 RP:SCP:REP 8->162|1eblA1|4e-57|46.5|155/174|c.95.1.2| RP:SCP:REP 216->331|1u0mA2|8e-32|23.3|116/148|c.95.1.2| HM:SCP:REP 7->333|1tedA_|4.8e-73|33.7|315/0|c.95.1.2|1/1|Thiolase-like| OP:NHOMO 1310 OP:NHOMOORG 858 OP:PATTERN ---11111-------1-----------------1-111----1-1---------111---1------- 11314---------21111-11--3-111112-11142211333212221111222121111112224631--------11-111111422114111--224332124141111111111111112111111121122211---3111111111111111112111111311111111111111121111-112444442253424222132212342111111111111142111111111111111121111-111111-1-2211111222211111111111111111111111111111111111111211111111111121222222212131223111-23--3111111111113111131122213222211111221111122222222222222222-33133112241222211121111112233112111122211111111111111111111111111--11111111211111111-211112111141121433333114155553321311111111111111211211113121221111111111111124212111112111123252222222223512111112221221111111111111111221-211211132222533222352223351-11111------12211111112111111-1111121111111111112111221111111111111111111211111111-11212221222211112222123331121-111111111111111111111-111--3333131411112-222111111111111132222232232224343333422221113--1111--------1-2-------------------------111---2---121 1-------1----1----------------------------------------------------------------------------------------------41----------------------------------------------------1-------------111A111115115-12-1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 335 STR:RPRED 100.0 SQ:SECSTR cccccccGTccccccccTcEEEETccGGGcTTcEEEEEEEEcccccTTcccccEEEEEEEETTTTccccccEEEEEEEEEEccccccHHHccHHHHcEEcccEEEEEGGGHHHcHHHHHHHHHHHHTHHHHccccccccccEEEEEccTTccGGGccccHHHHHHHHHTcccccccccccGGTEEcEEEEEEEEEEETTEEEEEEEEEEEccccGGGcccTTccHHHHccTHHHHHHHHHHHHHTcHHHHccEEEEEEEcccccHHHHHHHHHTHHHHHHTTTccccTTcEEEEEEEEccccccGGGccccccccccccGGGHEEEEEEcEEccc DISOP:02AL 1-5,334-336| PSIPRED cccccEEEEEEEEEEEcccccccHHHHHHHHcccHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHccccHHHccEEEEEccccccccccHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEEEHHcccccccccccEEEEEccEEEEEEccccccccccEEEEEEEcccccEEEEcccccccccccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHHHccHHHcccccccHHHHHHHHHHHHcccccccEEEEEEEEccccEEEEEEEEccccc //