[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50596.1
DDBJ      :             protein of unknown function DUF177
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->165 PF02620 * DUF177 4e-17 38.7 %
:HMM:PFM   55->164 PF02620 * DUF177 5.8e-30 37.3 110/119  
:BLT:SWISS 1->164 Y2951_MYCBO 9e-11 26.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50596.1 GT:GENE ABO50596.1 GT:PRODUCT protein of unknown function DUF177 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2275326..2275826) GB:FROM 2275326 GB:TO 2275826 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF177 GB:NOTE PFAM: protein of unknown function DUF177 KEGG: mta:Moth_0941 protein of unknown function DUF177 GB:PROTEIN_ID ABO50596.1 GB:DB_XREF GI:134052625 InterPro:IPR003772 LENGTH 166 SQ:AASEQ MIINILKIRNAPGEKISFHVSEQIDSVAVSGQRFSFVGAVEVSGEVINQNNQFLVKGQTRAVVSSDCVSCLEPVQLTIQGTIDEIYGKSNGHQDPDGEIIGFDGDVLNIEPEVIKSLLMEIPMRVVCSPDCRGLCQGCGCNLNIKQCDCENETIDPRLAILKKLQQ GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 1->164|Y2951_MYCBO|9e-11|26.1|161/207| RP:PFM:NREP 1 RP:PFM:REP 55->165|PF02620|4e-17|38.7|111/116|DUF177| HM:PFM:NREP 1 HM:PFM:REP 55->164|PF02620|5.8e-30|37.3|110/119|DUF177| OP:NHOMO 115 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- 11111------------11-1---1-1111111---1111------------1-1-11--11111---1---------1111---1-----------------------------------------------------11-----------------------------------------------11-1---------------------------------------11------------------------------------------------------------------------------------------111111-111111111-1111111-1---1111111111111111-1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-111111111111111111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 141-155| PSIPRED cEEEHHHHHccccccEEEEEEEEcccHHHHcccccccccEEEEEEEEEEccEEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEccccccccccccEEEEcccEEcHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHcc //