[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50602.1
DDBJ      :             putative methyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  870/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
a.131.1c.66.1
:184 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->181 2fhpA PDBj 9e-30 40.6 %
:RPS:PDB   19->149 3eeyI PDBj 4e-12 15.2 %
:RPS:SCOP  15->49 1pprM1  a.131.1.1 * 6e-04 35.3 %
:RPS:SCOP  28->180 2esrA1  c.66.1.46 * 1e-45 37.3 %
:HMM:SCOP  1->182 2fhpA1 c.66.1.46 * 2.9e-54 42.3 %
:RPS:PFM   1->180 PF03602 * Cons_hypoth95 2e-46 48.9 %
:HMM:PFM   1->181 PF03602 * Cons_hypoth95 2e-61 46.4 181/183  
:BLT:SWISS 1->181 YLBH_BACSU 9e-36 39.8 %
:PROS 117->123|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50602.1 GT:GENE ABO50602.1 GT:PRODUCT putative methyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2281604..2282158) GB:FROM 2281604 GB:TO 2282158 GB:DIRECTION - GB:PRODUCT putative methyltransferase GB:NOTE TIGRFAM: putative methyltransferase PFAM: conserved hypothetical protein 95 KEGG: ctc:CTC01232 methyltransferase GB:PROTEIN_ID ABO50602.1 GB:DB_XREF GI:134052631 InterPro:IPR002052 InterPro:IPR004398 LENGTH 184 SQ:AASEQ MRIIAGTARGRKLKSPKGMTTRPTSDRVREALFNILSSYVPGSRFLDLFSGTGAVAIEALSRGAEKATLVERDKNTARIIYDNLRMCNVLDKAEVLTVDVSQATLIMRRKKETFDLIFIDPPYKKGFEVPTLEKIQECHLLSSDGILVVESDQKDLPPDLVGNLTATRRERYGDTALTFYRLPS GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|YLBH_BACSU|9e-36|39.8|181/184| PROS 117->123|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 2->181|2fhpA|9e-30|40.6|175/177| RP:PDB:NREP 1 RP:PDB:REP 19->149|3eeyI|4e-12|15.2|125/186| RP:PFM:NREP 1 RP:PFM:REP 1->180|PF03602|2e-46|48.9|180/182|Cons_hypoth95| HM:PFM:NREP 1 HM:PFM:REP 1->181|PF03602|2e-61|46.4|181/183|Cons_hypoth95| RP:SCP:NREP 2 RP:SCP:REP 15->49|1pprM1|6e-04|35.3|34/156|a.131.1.1| RP:SCP:REP 28->180|2esrA1|1e-45|37.3|150/152|c.66.1.46| HM:SCP:REP 1->182|2fhpA1|2.9e-54|42.3|182/0|c.66.1.46|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 905 OP:NHOMOORG 892 OP:PATTERN -------------------------------------------------------------------- 111-1-1111111-11111-1111-111111-111111111111-111-11-1111111111111111111111111111111-11111111-111---1111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111211111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111211111-11-11111111111111-111111111111111111111111111111111--11111-1111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122121112-111112211111111111-1111111111111111111111111111111------1111111111111111-11-11--1111---11---1111111111111 11------1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------11-13111111122-111-1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 100.0 SQ:SECSTR EEEEEETTTEEEEEETTEcccccHHHHHHHHHHHHccHccTTcEEEEcccTTcHHHHHHHHHHcTEEEEEcccHHHHHHHHHHHHHTTcGGGEEEEcccHHHGGGGGGTccccEEEEEEEEccccccccccHHHHHHHHHEEEEEEEEEEEEETTcHHHGGHHHHHHHHHHHHHEEEEEEcccc PSIPRED cEEEEEEcccEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHcccccccEEEEEEcccccccccccccEEEEEEEEcccEEEEEEEEcc //