[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50606.1
DDBJ      :             LSU ribosomal protein L28P
Swiss-Prot:RL28_DESRM   RecName: Full=50S ribosomal protein L28;

Homologs  Archaea  0/68 : Bacteria  181/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:62 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->62 2jz6A PDBj 1e-11 43.3 %
:RPS:PDB   3->55 3bboY PDBj 4e-11 22.6 %
:RPS:SCOP  3->55 2j0111  d.325.1.1 * 5e-14 22.6 %
:HMM:SCOP  1->62 2j0111 d.325.1.1 * 9.7e-19 41.9 %
:HMM:PFM   2->56 PF00830 * Ribosomal_L28 9.6e-22 34.5 55/61  
:BLT:SWISS 1->62 RL28_DESRM 4e-33 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50606.1 GT:GENE ABO50606.1 GT:PRODUCT LSU ribosomal protein L28P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2285840..2286028 GB:FROM 2285840 GB:TO 2286028 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L28P GB:NOTE PFAM: ribosomal protein L28 KEGG: dsy:DSY2679 50S ribosomal protein L28 GB:PROTEIN_ID ABO50606.1 GB:DB_XREF GI:134052635 InterPro:IPR001383 LENGTH 62 SQ:AASEQ MAKCAICEKGVTVGIKLSHSHIRTKRTWNPNLQRVKAIVDGSPKRIMVCTRCLRSGKVQRAI GT:EXON 1|1-62:0| SW:ID RL28_DESRM SW:DE RecName: Full=50S ribosomal protein L28; SW:GN Name=rpmB; OrderedLocusNames=Dred_2089; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->62|RL28_DESRM|4e-33|100.0|62/62| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 3->62|2jz6A|1e-11|43.3|60/77| RP:PDB:NREP 1 RP:PDB:REP 3->55|3bboY|4e-11|22.6|53/76| HM:PFM:NREP 1 HM:PFM:REP 2->56|PF00830|9.6e-22|34.5|55/61|Ribosomal_L28| RP:SCP:NREP 1 RP:SCP:REP 3->55|2j0111|5e-14|22.6|53/88|d.325.1.1| HM:SCP:REP 1->62|2j0111|9.7e-19|41.9|62/0|d.325.1.1|1/1|L28p-like| OP:NHOMO 182 OP:NHOMOORG 181 OP:PATTERN -------------------------------------------------------------------- 11111---------1---------------------11111-1111-11-----------111-111111111111111--11-1111-------------------------------------------------------1-1------------------------------------------111111----------------1--11---111--1111111111-1111111111111-111-11111--1-111----11111--------------------------------------------------111111111111111111111111-1111--111111-11111111111-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-1-1111-1111111111-111-11----------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1--------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 96.8 SQ:SECSTR ##cccccccTTccccccEEcccccccEEccccccccccccccccccccccccTTTccccccc DISOP:02AL 1-1,62-63| PSIPRED ccccEEccccccccccEEHHccccccEEcccEEEEEEEEccEEEEEEEEEcccccccEEccc //