[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50611.1
DDBJ      :             acetate kinase
Swiss-Prot:ACKA_DESRM   RecName: Full=Acetate kinase;         EC=2.7.2.1;AltName: Full=Acetokinase;

Homologs  Archaea  3/68 : Bacteria  711/915 : Eukaryota  70/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:396 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->396 1tuuA PDBj e-128 59.1 %
:RPS:PDB   1->396 2e1zA PDBj 8e-92 41.3 %
:RPS:SCOP  1->197 1g99A1  c.55.1.2 * 3e-63 54.8 %
:RPS:SCOP  198->396 1g99A2  c.55.1.2 * 2e-45 64.8 %
:HMM:SCOP  1->197 1x3mA2 c.55.1.2 * 8.6e-73 53.7 %
:HMM:SCOP  157->398 1g99A2 c.55.1.2 * 5.1e-101 53.7 %
:RPS:PFM   2->389 PF00871 * Acetate_kinase e-123 57.0 %
:HMM:PFM   3->390 PF00871 * Acetate_kinase 4.5e-167 54.7 386/388  
:BLT:SWISS 1->396 ACKA_DESRM 0.0 100.0 %
:PROS 3->14|PS01075|ACETATE_KINASE_1
:PROS 204->221|PS01076|ACETATE_KINASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50611.1 GT:GENE ABO50611.1 GT:PRODUCT acetate kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2290150..2291340) GB:FROM 2290150 GB:TO 2291340 GB:DIRECTION - GB:PRODUCT acetate kinase GB:NOTE TIGRFAM: acetate kinase PFAM: acetate and butyrate kinase KEGG: mac:MA3606 acetate kinase GB:PROTEIN_ID ABO50611.1 GB:DB_XREF GI:134052640 InterPro:IPR000890 InterPro:IPR004372 LENGTH 396 SQ:AASEQ MLVLVVNCGSSSIKYKLMDMEQESVLLSGLSERIGIAGSRIKQENNKGEELVLEQDLPDHKAALETILKCITDAKYGAIKDTAEIKAVGHRVVHGGEKFNKSVVIDAELMKVLEEMSELAPLHNPPNIIGIKTCQELMPHAAQVAVFDTAFHSAMPKHAYTYAVPYEYYEKYKIRRYGFHGTSHKFVSHRAAEILGKPVEDLKIIVCHLGNGSSISAVGNGVSQDTSMGFTPLPGLPMGTRTGDMDPAIVPFLMEKEQLGVNEIGNVLNKKSGVLGVSGISSDFRDLEDAASKGNERAELALNMFAYGIIKYIGAYTAALGGLDAVVFTGGIGENSKTMRAKVLNGLAYTGLQIDEEKNNTRGKEVIVSKPGAPFVAMVVPTNEELMIARETKELV GT:EXON 1|1-396:0| SW:ID ACKA_DESRM SW:DE RecName: Full=Acetate kinase; EC=2.7.2.1;AltName: Full=Acetokinase; SW:GN Name=ackA; OrderedLocusNames=Dred_2094; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->396|ACKA_DESRM|0.0|100.0|396/396| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 3->14|PS01075|ACETATE_KINASE_1|PDOC00826| PROS 204->221|PS01076|ACETATE_KINASE_2|PDOC00826| SEG 166->177|yeyyekykirry| BL:PDB:NREP 1 BL:PDB:REP 1->396|1tuuA|e-128|59.1|396/399| RP:PDB:NREP 1 RP:PDB:REP 1->396|2e1zA|8e-92|41.3|387/394| RP:PFM:NREP 1 RP:PFM:REP 2->389|PF00871|e-123|57.0|384/387|Acetate_kinase| HM:PFM:NREP 1 HM:PFM:REP 3->390|PF00871|4.5e-167|54.7|386/388|Acetate_kinase| GO:PFM:NREP 5 GO:PFM GO:0005622|"GO:intracellular"|PF00871|IPR000890| GO:PFM GO:0008152|"GO:metabolic process"|PF00871|IPR000890| GO:PFM GO:0016301|"GO:kinase activity"|PF00871|IPR000890| GO:PFM GO:0016310|"GO:phosphorylation"|PF00871|IPR000890| GO:PFM GO:0016774|"GO:phosphotransferase activity, carboxyl group as acceptor"|PF00871|IPR000890| RP:SCP:NREP 2 RP:SCP:REP 1->197|1g99A1|3e-63|54.8|197/197|c.55.1.2| RP:SCP:REP 198->396|1g99A2|2e-45|64.8|199/201|c.55.1.2| HM:SCP:REP 1->197|1x3mA2|8.6e-73|53.7|188/0|c.55.1.2|1/1|Actin-like ATPase domain| HM:SCP:REP 157->398|1g99A2|5.1e-101|53.7|242/242|c.55.1.2|1/1|Actin-like ATPase domain| OP:NHOMO 1113 OP:NHOMOORG 784 OP:PATTERN --------------------------------------------------111--------------- 1-2-111111111111111-11--1111111111111111111111111111-11111--111-2-1111111111111112------21221111--1-11--11------------------111-1---1111----------121111111111---1--111111-------------212--112-11222222222222122111111222121-1213223231111111111111111111111243122112323322223222212221111111111111111111111111111111111212111111114233222222212113111333121111111-2211-1141132312111-21--2-----122233111611211111111111-37233212111-1---1112111121--12-111112-111111111111--1-4-------------111-11--1--1----------1111-11111111-1132111111-11431221--11-2--1113-11-1-111--212222222111213-2--11211-211113231323323333--213111111111111-1-21-31---11-22511-1-1-211111112111111111211-1111-11111131111212222222322-22222232222322222223331111133333333333333331222222211311111111111--11-----11111-1-111111111111111111111-11113-1111----1----21--111111111-22222222222222-----------------1------1111111111111111-2111111111111111111133332222211- --------------1-11111111111--11111111111-1111111111111-1111111---------------------------12-111-11111-1-----1-------------------------------------------------1----1------------22-----212--11-61-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccEEEEEEEETTTccEEEEEEEEcTTccccEEEETTcccEETTcEcccccHHHHHHHHHHHHHTTTcGGEEEEcGEEEEEEEEcccTTTccccEEccHHHHHHHHHHGGGcHHHHHHHHHHHHHHHHHcTTcEEEEEETTGGGGGccHHHHcccccHHHHHTTccccccccHHHHHHHHHHHHHHTTccTTccEEEEEEEcccEEEEEEETTEEEEEcccccTTcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHTTcccccEEEEEHHHHHHcHHHHHHHHHTTGGGTccccHHHHHccGccEEcccTTcccEEEEccccHHHHHHHHHHHHT PSIPRED cEEEEEcccccEEEEEEEEcccccEEEEEEEccccccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHccccccccHHHccEEEEEEccccccccccEEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHcccccHHHHHHHcccEEHHHHHHHHHHHHHHHHHHcccHHHccEEEEEccccEEEEEEcccEEEEEccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHccccccEEEcHHHHHccccccEEccccccEEEEEEcccHHHHHHHHHHHHc //