[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50615.1
DDBJ      :             Type II secretory pathway component ExeA (predicted ATPase)-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  143/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:257 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  37->148 2fnaA2  c.37.1.20 * 4e-04 25.0 %
:HMM:SCOP  37->248 2fnaA2 c.37.1.20 * 2.5e-16 25.2 %
:BLT:SWISS 91->237 GSPA_AERHY 6e-19 34.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50615.1 GT:GENE ABO50615.1 GT:PRODUCT Type II secretory pathway component ExeA (predicted ATPase)-like protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2295401..2296174 GB:FROM 2295401 GB:TO 2296174 GB:DIRECTION + GB:PRODUCT Type II secretory pathway component ExeA (predicted ATPase)-like protein GB:NOTE KEGG: sth:STH2719 hypothetical protein GB:PROTEIN_ID ABO50615.1 GB:DB_XREF GI:134052644 LENGTH 257 SQ:AASEQ MLHRHGKYNRHAYTPEDQSHIPIYRFICPNPNCRKTTALLPAFLKEHHPISFDIQEKVIRQQAEGKTLVQLSGELLRHLGEETPFSITKAKRLFDEALMARTAQGGKELVIILDEAQDISSSLLLELRFARNQQMDSLSLFTLILVGQPELRRTLRMNKFEAITQRIQLRYHLTGLMAEETATYICHQMKTASLTTPLFSDSAIKLIHTETKGIPRLINSLCSQALYDAKRRNSDVIEESMIGRILADAERQRGTVG GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 91->237|GSPA_AERHY|6e-19|34.9|146/547| RP:SCP:NREP 1 RP:SCP:REP 37->148|2fnaA2|4e-04|25.0|112/278|c.37.1.20| HM:SCP:REP 37->248|2fnaA2|2.5e-16|25.2|202/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 304 OP:NHOMOORG 143 OP:PATTERN -------------------------------------------------------------------- --1--------------11-11----11111-5--1--11---------------------------------------------211--------------------------------------------------------------------------------------------------------2-------------------------56-----------------------------------------------------------------------------------------------------------------------------------4--1---185---3-58------11-------------1-------1-----------------------------------------21-----1----------1------1-------------------------------111---------------------------------------21111-111--1-M2121-1-------112113-15---21--1111-53523332A22121-16-------------------------12221323323212222222222221222232---1122--------------------------------------------------------------------------------------------1---------1-2---------------------------12--------------------------122222222222222----------------1------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,253-258| PSIPRED cccccccHHHEEEcccccEEEEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHccHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHcccccccHHHEEEEEEEcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccc //