[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50618.1
DDBJ      :             manganese and iron superoxide dismutase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  211/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
a.2.11d.352.1d.44.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->209 1cojA PDBj 3e-29 37.0 %
:RPS:PDB   29->202 2cw3A PDBj 9e-31 25.0 %
:RPS:SCOP  29->124 2hc5A1  d.352.1.1 * 7e-07 14.9 %
:RPS:SCOP  95->202 1ap5A2  d.44.1.1 * 3e-14 34.0 %
:HMM:SCOP  12->96 1cojA1 a.2.11.1 * 1.2e-05 18.8 %
:HMM:SCOP  96->207 1cojA2 d.44.1.1 * 6e-26 37.5 %
:RPS:PFM   103->201 PF02777 * Sod_Fe_C 9e-13 36.7 %
:HMM:PFM   103->201 PF02777 * Sod_Fe_C 6.2e-22 34.3 99/106  
:HMM:PFM   5->13 PF02977 * CarbpepA_inh 0.00037 55.6 9/46  
:HMM:PFM   35->122 PF08458 * PH_2 0.00042 21.8 87/110  
:BLT:SWISS 19->209 SODF_AQUAE 5e-29 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50618.1 GT:GENE ABO50618.1 GT:PRODUCT manganese and iron superoxide dismutase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2300036..2300665 GB:FROM 2300036 GB:TO 2300665 GB:DIRECTION + GB:PRODUCT manganese and iron superoxide dismutase GB:NOTE PFAM: manganese and iron superoxide dismutase KEGG: tte:TTE0857 superoxide dismutase GB:PROTEIN_ID ABO50618.1 GB:DB_XREF GI:134052647 InterPro:IPR001189 LENGTH 209 SQ:AASEQ MYIPDCSDGTFCPIEARSLKPQLLSMMGFSPRQIQEHYKIYQSYITKTNEVRMKLRSIDMQGSNSIHSSYRSLKIDESQTVANGKLHEMYFDNLGGNGRTAIGKVLEIIVKDFGSYEFWERDFRSTGLASQGWVILGYDFDDCHLHNYTQGAPDVVPIVRFEPLLVLDVCEHAYFLDYGTNRNSYIDAFFRNIDWYTVNSRLQNLKSTY GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 19->209|SODF_AQUAE|5e-29|37.0|189/213| BL:PDB:NREP 1 BL:PDB:REP 19->209|1cojA|3e-29|37.0|189/211| RP:PDB:NREP 1 RP:PDB:REP 29->202|2cw3A|9e-31|25.0|172/200| RP:PFM:NREP 1 RP:PFM:REP 103->201|PF02777|9e-13|36.7|98/104|Sod_Fe_C| HM:PFM:NREP 3 HM:PFM:REP 103->201|PF02777|6.2e-22|34.3|99/106|Sod_Fe_C| HM:PFM:REP 5->13|PF02977|0.00037|55.6|9/46|CarbpepA_inh| HM:PFM:REP 35->122|PF08458|0.00042|21.8|87/110|PH_2| GO:PFM:NREP 4 GO:PFM GO:0004784|"GO:superoxide dismutase activity"|PF02777|IPR019832| GO:PFM GO:0006801|"GO:superoxide metabolic process"|PF02777|IPR019832| GO:PFM GO:0046872|"GO:metal ion binding"|PF02777|IPR019832| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02777|IPR019832| RP:SCP:NREP 2 RP:SCP:REP 29->124|2hc5A1|7e-07|14.9|87/109|d.352.1.1| RP:SCP:REP 95->202|1ap5A2|3e-14|34.0|106/115|d.44.1.1| HM:SCP:REP 12->96|1cojA1|1.2e-05|18.8|85/89|a.2.11.1|1/1|Fe,Mn superoxide dismutase (SOD), N-terminal domain| HM:SCP:REP 96->207|1cojA2|6e-26|37.5|112/122|d.44.1.1|1/1|Fe,Mn superoxide dismutase (SOD), C-terminal domain| OP:NHOMO 402 OP:NHOMOORG 338 OP:PATTERN 11----1111111111-1------12221221--1--------1--111-111--------111--1- 1----111111111111-----11-2-------1111111------2-111-----1-11----1---1--------------11-111111-1-------11---11--------------------------1----11111--2---11-------------1----1---------------------11---------------1-1111---1-1----------1-1-----------------------11-----------1-----111---11----------------1111-1111111--------------1-2222222-2-11221111-1-------122-2---1----1-----11----1----1-2------1--1--------------1--2-----------------------------------------------2---111111--1-1111111111111--------1----------------------------41---1------------1-1---------------------------1----------111-111--1111-111----1-----11111111111----11----1--1-----------1-----1-------1---------1-----------------------------------1-----111---1---1------1-----------------------1--------111111--------------1--------------1-------------------------------------------1-1--111--------11----------1---1111------------------------1-------1-1 11--12--622-11111-1-------111-----11-111111111111-----11---111-----------------------------111-1----1--111---3113111-----1-------373-3121---------11--1--------1111111--132-2111-2171111-1111112-11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 99.0 SQ:SECSTR ##ccccccTTTTcccTTTTTTTcTTTTTccHHHHHHHHHTHHHHHHHHHHHHcccGGGccHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHTcTcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEEEETTTTEEEEEETccHHHHTcTcEEEEEEEEccGGGTHHHHTTcHHHHHHHHHTTccHHHHHHTcHHHTcHH DISOP:02AL 97-102,208-210| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHcccccccEEEEEEEccccEEEEEEccccccccccccEEEEEEEHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHc //