[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50619.1
DDBJ      :             cell wall hydrolase, SleB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->154 1y7mA PDBj 2e-04 30.8 %
:RPS:PDB   49->104 2djpA PDBj 6e-11 26.8 %
:RPS:SCOP  53->97 1y7mA2  d.7.1.1 * 2e-11 33.3 %
:HMM:SCOP  52->99 1y7mA2 d.7.1.1 * 7.7e-11 37.5 %
:RPS:PFM   55->96 PF01476 * LysM 3e-05 45.2 %
:RPS:PFM   131->232 PF07486 * Hydrolase_2 6e-24 57.7 %
:HMM:PFM   130->233 PF07486 * Hydrolase_2 2.3e-33 55.4 101/108  
:HMM:PFM   55->97 PF01476 * LysM 9.1e-15 37.2 43/44  
:BLT:SWISS 55->96 MUR2_ENTHR 2e-07 40.5 %
:BLT:SWISS 114->232 SLEB_BACHD 7e-28 49.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50619.1 GT:GENE ABO50619.1 GT:PRODUCT cell wall hydrolase, SleB GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2300710..2301429) GB:FROM 2300710 GB:TO 2301429 GB:DIRECTION - GB:PRODUCT cell wall hydrolase, SleB GB:NOTE PFAM: Peptidoglycan-binding LysM; cell wall hydrolase, SleB KEGG: dsy:DSY3257 hypothetical protein GB:PROTEIN_ID ABO50619.1 GB:DB_XREF GI:134052648 InterPro:IPR002482 InterPro:IPR011105 LENGTH 239 SQ:AASEQ MNKKYRKIATLMAVLVAVTSSFMVATVATGAAGDGAGGLECEGSDPDRSSSEVYYTVQPGDTLYQVCRDYHVSLGSLMRANNLKNTTIYPDQRLVIPTVSISSYGMVLSRGDVSREDIKLLARLIHAEARGETFEGKVAVGAVILNRLVSPGFPKSIREIILENNNLVYQFSPVQDGSINLEPDEDSMKAALEALMGRDPTGGALFFYNPIVATDKWIKTLPVVTRIGNHVFATKATKI GT:EXON 1|1-239:0| BL:SWS:NREP 2 BL:SWS:REP 55->96|MUR2_ENTHR|2e-07|40.5|42/666| BL:SWS:REP 114->232|SLEB_BACHD|7e-28|49.6|115/330| TM:NTM 1 TM:REGION 8->30| SEG 24->38|vatvatgaagdgagg| BL:PDB:NREP 1 BL:PDB:REP 55->154|1y7mA|2e-04|30.8|91/161| RP:PDB:NREP 1 RP:PDB:REP 49->104|2djpA|6e-11|26.8|56/77| RP:PFM:NREP 2 RP:PFM:REP 55->96|PF01476|3e-05|45.2|42/44|LysM| RP:PFM:REP 131->232|PF07486|6e-24|57.7|97/106|Hydrolase_2| HM:PFM:NREP 2 HM:PFM:REP 130->233|PF07486|2.3e-33|55.4|101/108|Hydrolase_2| HM:PFM:REP 55->97|PF01476|9.1e-15|37.2|43/44|LysM| GO:PFM:NREP 4 GO:PFM GO:0016998|"GO:cell wall macromolecule catabolic process"|PF01476|IPR018392| GO:PFM GO:0005618|"GO:cell wall"|PF07486|IPR011105| GO:PFM GO:0009847|"GO:spore germination"|PF07486|IPR011105| GO:PFM GO:0016787|"GO:hydrolase activity"|PF07486|IPR011105| RP:SCP:NREP 1 RP:SCP:REP 53->97|1y7mA2|2e-11|33.3|45/48|d.7.1.1| HM:SCP:REP 52->99|1y7mA2|7.7e-11|37.5|48/0|d.7.1.1|1/1|LysM domain| OP:NHOMO 208 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------22222222123222222222222222233312--------44------------------------------------------------------------------------------------------22231333333312111333111123--3-23322555-51233332-------11-------------------1111111-111---------1-1-1---11-111-1-------1----1----------------11----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 40.6 SQ:SECSTR ################################################cEEEEEEcccTTccHHHHHHHHTccHHHHHHHHTcccccGGGcccEEEEEEcccccEEEEEETTEEEEEEccEEcTTcccccEEEE#########EEEEEEcccGG##################################################################################### DISOP:02AL 1-4,28-51,239-240| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccHHHHHHHHcccHHHHHHHcccccccEEcccEEEcccccccccccccccccccccHHHHHHHccEEEEccccHHHHHHHHHHHEEEcccccccccHHHEEEcccccccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEcccccccHHHcccEEEEEEccEEEEcccccc //