[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50624.1
DDBJ      :             histidine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  540/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:379 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   176->376 3gigA PDBj 4e-18 29.5 %
:RPS:PDB   72->170 2an2A PDBj 3e-04 19.4 %
:RPS:PDB   163->369 3ehjA PDBj 1e-20 20.1 %
:RPS:SCOP  249->377 1id0A  d.122.1.3 * 9e-11 14.3 %
:HMM:SCOP  243->377 1b3qA3 d.122.1.3 * 3.9e-22 23.7 %
:RPS:PFM   9->165 PF05384 * DegS 2e-32 50.3 %
:RPS:PFM   177->241 PF07730 * HisKA_3 5e-06 33.8 %
:RPS:PFM   340->377 PF02518 * HATPase_c 5e-06 44.7 %
:HMM:PFM   9->167 PF05384 * DegS 2.1e-60 52.8 159/159  
:HMM:PFM   177->244 PF07730 * HisKA_3 1.2e-19 39.7 68/68  
:HMM:PFM   286->378 PF02518 * HATPase_c 7.7e-15 22.6 93/111  
:BLT:SWISS 2->368 DEGS_BREBE 7e-75 41.3 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50624.1 GT:GENE ABO50624.1 GT:PRODUCT histidine kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2305874..2307013 GB:FROM 2305874 GB:TO 2307013 GB:DIRECTION + GB:PRODUCT histidine kinase GB:NOTE PFAM: ATP-binding region, ATPase domain protein domain protein; Sensor DegS domain protein; histidine kinase, dimerisation and phosphoacceptor region KEGG: mta:Moth_0974 histidine kinase GB:PROTEIN_ID ABO50624.1 GB:DB_XREF GI:134052653 InterPro:IPR003594 InterPro:IPR004358 InterPro:IPR005467 InterPro:IPR008595 InterPro:IPR011712 LENGTH 379 SQ:AASEQ MVADVKILDNIIKETISVIEKSKEQIYYIAESAHLEWQRVENEIKQTKYQLGKIIDEVNKLEIEERRARVRLMEVSRDFDRYNEAAIKQAYEQAQVTQLRLVMLREEEKTLRFKRDHLEISLKRMKDTADRAEKLVSQVGVALQYLSKDLSGVSEKLTNLHDMQQLGISIIRAQEEERKRVAREIHDGPAQSMANIVMRAEFCLKLLEMNPSMVGNELVSLQQLVRQSLQDVRKIIFDLRPMVLDDLGLIPAVKRYLEDYKVQNNISADFVFIGKEQRFDASMEVAVFRIIQEALINIKKHAAARHVLIKMELISSRINVYIKDDGCGFVVGHIKPRGDGSGYGLLGMRERIQLLKGTLSINSTPGKGTELNFSLPLDT GT:EXON 1|1-379:0| BL:SWS:NREP 1 BL:SWS:REP 2->368|DEGS_BREBE|7e-75|41.3|363/386| COIL:NAA 33 COIL:NSEG 1 COIL:REGION 121->153| SEG 218->230|lvslqqlvrqslq| BL:PDB:NREP 1 BL:PDB:REP 176->376|3gigA|4e-18|29.5|183/212| RP:PDB:NREP 2 RP:PDB:REP 72->170|2an2A|3e-04|19.4|98/360| RP:PDB:REP 163->369|3ehjA|1e-20|20.1|189/196| RP:PFM:NREP 3 RP:PFM:REP 9->165|PF05384|2e-32|50.3|157/159|DegS| RP:PFM:REP 177->241|PF07730|5e-06|33.8|65/68|HisKA_3| RP:PFM:REP 340->377|PF02518|5e-06|44.7|38/112|HATPase_c| HM:PFM:NREP 3 HM:PFM:REP 9->167|PF05384|2.1e-60|52.8|159/159|DegS| HM:PFM:REP 177->244|PF07730|1.2e-19|39.7|68/68|HisKA_3| HM:PFM:REP 286->378|PF02518|7.7e-15|22.6|93/111|HATPase_c| GO:PFM:NREP 7 GO:PFM GO:0007165|"GO:signal transduction"|PF05384|IPR008595| GO:PFM GO:0016301|"GO:kinase activity"|PF05384|IPR008595| GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07730|IPR011712| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07730|IPR011712| GO:PFM GO:0016021|"GO:integral to membrane"|PF07730|IPR011712| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF07730|IPR011712| GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 249->377|1id0A|9e-11|14.3|126/146|d.122.1.3| HM:SCP:REP 243->377|1b3qA3|3.9e-22|23.7|135/185|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 1378 OP:NHOMOORG 543 OP:PATTERN -------------------------------------------------------------------- 67B182121111-121111-13--261111113222277A11-4122-12214233----23442518A5---------22-4-----11---------3-6131A3612-------------------1------9BB88455F44--3---1----------1-1225-------------34321--12573343477736457676487585762338422111111C8433333323333333234321---22-1--122-122211-1-111111121222222222222222111111111111131111-1112-314-1111121-1-11--1---1-1--8111-85-21123-21-1----31-1--------133-1--12123311-111-1-12-22123-31--1-211131122222---1-1------111------------21--------------------------------------11-153454433333446C5555244563465--663464433567423414635111111111113514-2411-21-31--1-3-421421322122-26---------------------------22-11-3-11-2-----12-22---24-23----211------3-13-211222122211-211121311122111111222233--2222121222122221211111111---11111-11111---2---------1-2-1111--1-------------------2-33232423433323222----------11-233333121223322222112----11------11--------1-------------------------------------1B- -------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 87.1 SQ:SECSTR #################################################ccHHHHHHHTTcGGGHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHTcHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHTTcccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHTcccEEEEEEEEcccEEEEEEEEccccccHHHHHTccTTcccHHHHHHHHHHHTTcEEEEEccccEEEEEEEEEEccc DISOP:02AL 1-1,160-161,208-215,334-340| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEEccccccHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEEccc //