[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50628.1
DDBJ      :             peptidase A24A, prepilin type IV
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->91 1rc2B PDBj 3e-04 37.0 %
:RPS:PFM   7->106 PF01478 * Peptidase_A24 2e-08 38.0 %
:HMM:PFM   6->106 PF01478 * Peptidase_A24 4.1e-17 31.7 101/106  
:BLT:SWISS 18->116 LEP4_XANCP 3e-07 35.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50628.1 GT:GENE ABO50628.1 GT:PRODUCT peptidase A24A, prepilin type IV GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2308408..2308911 GB:FROM 2308408 GB:TO 2308911 GB:DIRECTION + GB:PRODUCT peptidase A24A, prepilin type IV GB:NOTE PFAM: peptidase A24A, prepilin type IV KEGG: sat:SYN_01490 flp pilus assembly protein, protease GB:PROTEIN_ID ABO50628.1 GB:DB_XREF GI:134052657 InterPro:IPR000045 InterPro:IPR000425 LENGTH 167 SQ:AASEQ MLSDIALITVVLISLYTDLRYRKIYNAVLFPTFLLALTYWFVSGGLGGILFSIKGATLGLALLLIPFMLGGMGAGDVKLLAVIGAWQGPQFVWLCFLCTAIVGGIIAAVQLSKSGRLLQSLKYILFTFLPGAPKAHAFGTLTTAKAGEAFPYGVAIASGTFATYLLR GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 18->116|LEP4_XANCP|3e-07|35.1|94/287| TM:NTM 5 TM:REGION 1->20| TM:REGION 27->49| TM:REGION 61->83| TM:REGION 90->112| TM:REGION 146->167| BL:PDB:NREP 1 BL:PDB:REP 38->91|1rc2B|3e-04|37.0|54/231| RP:PFM:NREP 1 RP:PFM:REP 7->106|PF01478|2e-08|38.0|100/107|Peptidase_A24| HM:PFM:NREP 1 HM:PFM:REP 6->106|PF01478|4.1e-17|31.7|101/106|Peptidase_A24| GO:PFM:NREP 2 GO:PFM GO:0004190|"GO:aspartic-type endopeptidase activity"|PF01478|IPR000045| GO:PFM GO:0016020|"GO:membrane"|PF01478|IPR000045| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1-1---------1---------------------------------------------------------------------------------------------------------------------------------1----1-------1----------111----1--------------------------------------11-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 32.3 SQ:SECSTR #####################################HHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHTTcc############################################################################ DISOP:02AL 1-1,141-141,143-143| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHc //