[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50654.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:HMM:PFM   35->59 PF01666 * DX 5e-05 28.0 25/76  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50654.1 GT:GENE ABO50654.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2336803..2337093) GB:FROM 2336803 GB:TO 2337093 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50654.1 GB:DB_XREF GI:134052683 LENGTH 96 SQ:AASEQ MVFLDLSFFHYFNYITPIIDVTKLIEMFYDIFNLRCINNMQCFTSTICVRVNVPTLRCTTKFGENLLYVSLFEPARLMIKKNEVNMAKEILSSIIT GT:EXON 1|1-96:0| HM:PFM:NREP 1 HM:PFM:REP 35->59|PF01666|5e-05|28.0|25/76|DX| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHEEEEEEEcccEEEEEHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcc //