[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50659.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->87 PF05058 * ActA 0.00023 33.3 42/633  
:BLT:SWISS 9->106 GLE1_DICDI 9e-05 24.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50659.1 GT:GENE ABO50659.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2341514..2341879) GB:FROM 2341514 GB:TO 2341879 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50659.1 GB:DB_XREF GI:134052688 LENGTH 121 SQ:AASEQ MFNDPRFALFSLTLLSQNHPDILERMQNFSLWLKQTGESLASIQNAMSEYEASMLSLAASQSTPKELTNQQQPFTTMIMKDGRNAKQVTEQVLSRLSESSLDKLESFLEELNQLILKYGDK GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 9->106|GLE1_DICDI|9e-05|24.5|98/100| HM:PFM:NREP 1 HM:PFM:REP 44->87|PF05058|0.00023|33.3|42/633|ActA| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,59-69,120-122| PSIPRED ccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //