[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50663.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 2->78 YDBD_ECOLI 5e-04 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50663.1 GT:GENE ABO50663.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2350410..2350742) GB:FROM 2350410 GB:TO 2350742 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50663.1 GB:DB_XREF GI:134052692 LENGTH 110 SQ:AASEQ MKIGNQEKPTFAQFRESFLMTLHQITGMNVNTCDSWLTMGDSEIREKTIREFIRLNEQQYGFEIVLLGQLNNKEGSIEGVIGELYHVFSTMFLVEVINSKIRAGEKRVEI GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 2->78|YDBD_ECOLI|5e-04|28.6|77/100| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,107-107,109-111| PSIPRED ccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHccHHHccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccc //