[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50671.1
DDBJ      :             putative CheW protein
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  442/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.40.7
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->135 2qdlB PDBj 6e-26 40.3 %
:RPS:PDB   5->139 2ch4W PDBj 2e-24 31.3 %
:RPS:SCOP  5->139 2ch4W1  b.40.7.1 * 1e-24 31.3 %
:HMM:SCOP  5->140 1k0sA_ b.40.7.1 * 4.6e-34 37.8 %
:RPS:PFM   9->139 PF01584 * CheW 2e-21 35.9 %
:HMM:PFM   8->138 PF01584 * CheW 1.5e-39 38.8 129/138  
:BLT:SWISS 7->139 CHEW_BACSU 2e-21 36.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50671.1 GT:GENE ABO50671.1 GT:PRODUCT putative CheW protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2359320..2359739 GB:FROM 2359320 GB:TO 2359739 GB:DIRECTION + GB:PRODUCT putative CheW protein GB:NOTE PFAM: CheW domain protein KEGG: chy:CHY_0966 chemotaxis protein CheW GB:PROTEIN_ID ABO50671.1 GB:DB_XREF GI:134052700 InterPro:IPR002545 LENGTH 139 SQ:AASEQ MVAGQEEQLVVFQLNDQQYALPINETQEIIRMAEVTKLPNTTFYIEGIINLRGTILPVISLNRRLGLPETEQNEDTRIIVVENKGNKVGMIVDSVLEVGRYTEAEVEPPNMIGNNVDYLKGVVKKEDQLWLLINLDTVL GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 7->139|CHEW_BACSU|2e-21|36.8|133/156| BL:PDB:NREP 1 BL:PDB:REP 7->135|2qdlB|6e-26|40.3|129/146| RP:PDB:NREP 1 RP:PDB:REP 5->139|2ch4W|2e-24|31.3|134/139| RP:PFM:NREP 1 RP:PFM:REP 9->139|PF01584|2e-21|35.9|131/135|CheW| HM:PFM:NREP 1 HM:PFM:REP 8->138|PF01584|1.5e-39|38.8|129/138|CheW| GO:PFM:NREP 4 GO:PFM GO:0004871|"GO:signal transducer activity"|PF01584|IPR002545| GO:PFM GO:0005622|"GO:intracellular"|PF01584|IPR002545| GO:PFM GO:0006935|"GO:chemotaxis"|PF01584|IPR002545| GO:PFM GO:0007165|"GO:signal transduction"|PF01584|IPR002545| RP:SCP:NREP 1 RP:SCP:REP 5->139|2ch4W1|1e-24|31.3|134/139|b.40.7.1| HM:SCP:REP 5->140|1k0sA_|4.6e-34|37.8|135/0|b.40.7.1|1/1|CheW-like| OP:NHOMO 1070 OP:NHOMOORG 467 OP:PATTERN -----------------------12--1-111---1--1111238-17-1212-1-1-11-------- 121-------------------------------------1---1---1---------------1-------------------2112--------------------1----------------------------11-----------11------------------1--------------------132--1-11111111111132232111312222211111121------------------------------------------------------------------------------------------64325222122222242331---217--3213233321331212245---32-5332-----1145711145116--------------1----2----4227553555331-2-1-1-343312---------1111--23-----------------------------------111111111113222211--22232311-1111--11131-----222-432112453-------112-22262212444E4556387769A94555153531-222-2222222122222223321---65-3232112-3444442344444522445----222------11111111111111111-1111111111111111111---1111-11111111111111111-1-11111-111111111111---1-----------614---------------111111-11--322223446534343555---------3222255555332333322322222------234444433333333322--------------------------2-22221222-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 97.1 SQ:SECSTR ####cEEEEEEEEcTTccEEEcTTTEEEEEEcccccccccccTTEEEEEEETTEEEEEEEHHHHHTccccTcTTccEEEEEEccccEEEEEEcEEEEEEEEETTTccccTTTcccTTTEEEEccccccccEEEcHHHHH DISOP:02AL 1-2,109-112| PSIPRED cccccEEEEEEEEEccEEEEEEHHHcEEEEEccccEEccccccHHEEEEEEccEEEEEEEHHHHcccccccccccEEEEEEEEccEEEEEEEEEcccEEEccHHHEEccHHHcccccEEEEEEEEccEEEEEEEHHHHc //