[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50672.1
DDBJ      :             protein of unknown function DUF74
Swiss-Prot:Y2155_DESRM  RecName: Full=UPF0145 protein Dred_2155;

Homologs  Archaea  17/68 : Bacteria  268/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.230.5
:103 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->103 1vr4A PDBj 2e-38 68.0 %
:RPS:SCOP  1->103 1vr4A1  d.230.5.1 * 4e-32 68.0 %
:HMM:SCOP  1->103 1y2iA_ d.230.5.1 * 6.1e-37 52.4 %
:RPS:PFM   2->103 PF01906 * DUF74 2e-21 56.9 %
:HMM:PFM   1->102 PF01906 * DUF74 2.8e-42 55.9 102/105  
:BLT:SWISS 1->103 Y2155_DESRM 2e-53 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50672.1 GT:GENE ABO50672.1 GT:PRODUCT protein of unknown function DUF74 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2359842..2360153) GB:FROM 2359842 GB:TO 2360153 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF74 GB:NOTE PFAM: protein of unknown function DUF74 KEGG: swo:Swol_2464 hypothetical protein GB:PROTEIN_ID ABO50672.1 GB:DB_XREF GI:134052701 InterPro:IPR002765 LENGTH 103 SQ:AASEQ MIITTTGIIEGKPIRQYFGLVNGEAIMGANVVRDIFASITDIVGGRSGAYESKLAHAREIALEEMTEQARRMGANAIVGVDLDYEVIREGMLMVSASGTAVQI GT:EXON 1|1-103:0| SW:ID Y2155_DESRM SW:DE RecName: Full=UPF0145 protein Dred_2155; SW:GN OrderedLocusNames=Dred_2155; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->103|Y2155_DESRM|2e-53|100.0|103/103| BL:PDB:NREP 1 BL:PDB:REP 1->103|1vr4A|2e-38|68.0|103/103| RP:PFM:NREP 1 RP:PFM:REP 2->103|PF01906|2e-21|56.9|102/105|DUF74| HM:PFM:NREP 1 HM:PFM:REP 1->102|PF01906|2.8e-42|55.9|102/105|DUF74| RP:SCP:NREP 1 RP:SCP:REP 1->103|1vr4A1|4e-32|68.0|103/103|d.230.5.1| HM:SCP:REP 1->103|1y2iA_|6.1e-37|52.4|103/0|d.230.5.1|1/1|YbjQ-like| OP:NHOMO 329 OP:NHOMOORG 286 OP:PATTERN ----1-----------1------------11-111-1----11-1-1---1----1---11-1----- --1--------11--------------------------------------------------------------111--11---1--1111-1-------------1-1-------------------------------111-11--1---11------1-11-11111---------------2211--11122233222242343-211--423-111---11111112----------------------1-11--1-111--1111---------------------------------------------------1----1111121121-111111--11--1---1111112-11----1--1--1211---------------------------------------------------------1113-12111111-------------121------------------------------1--1-------11---1111111--111111-----------------1---------------------1-111---------------------1-----------------------1------------1112-1--1-111------1-------------------------1111-111111111111-1111111111111111111---11---111111111111111111111111----------------11-----1111--1--111-1-1-------1------1---------111--1111-----------------11111111111-1---------------2------------------------------------------1--1111111--- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 100.0 SQ:SECSTR cEEccccccTTccccEEEEEEEEEEEEcHHHHHTTcGGGcccccTTTTccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEEEEEEEGGGEEEEEEEEEEEEc PSIPRED cEEEcccccccEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHHcccEEEEEEEEEEEEc //