[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50676.1
DDBJ      :             Radical SAM domain protein
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  427/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->110 2fb2B PDBj 8e-10 32.4 %
:RPS:PDB   3->275 3cixA PDBj 1e-20 9.4 %
:RPS:SCOP  3->267 1tv7A  c.1.28.3 * 2e-32 19.3 %
:HMM:SCOP  3->303 1tv8A_ c.1.28.3 * 1e-73 37.7 %
:RPS:PFM   8->110 PF04055 * Radical_SAM 2e-11 43.4 %
:HMM:PFM   6->161 PF04055 * Radical_SAM 8.6e-31 27.7 155/166  
:BLT:SWISS 4->283 ALBA_BACSU 9e-23 27.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50676.1 GT:GENE ABO50676.1 GT:PRODUCT Radical SAM domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2362516..2363508) GB:FROM 2362516 GB:TO 2363508 GB:DIRECTION - GB:PRODUCT Radical SAM domain protein GB:NOTE PFAM: Radical SAM domain protein SMART: Elongator protein 3/MiaB/NifB KEGG: chy:CHY_1211 radical SAM domain protein GB:PROTEIN_ID ABO50676.1 GB:DB_XREF GI:134052705 InterPro:IPR006638 InterPro:IPR007197 LENGTH 330 SQ:AASEQ MIISWNTTNACNLYCEHCYRDAGVKAEEELSTDEGKRLLDQIAEVGFKIMIFSGGEPLMRPDIYELVAHARSKGLRPVFGTNGTLITPEVAKRLKESGALGMGISLDSVDPAKHDKFRAQEGCWQAAVEGMRNCRRAGLPFQIHTTVMDWNYEEVEDLTDFAVQEGAVAHHVFFLVPTGRAVNIEQESLRAEQYENLLHRIMEKQKQVDIELKPTCAPQFMRIAKQMGVDTRFQRGCLAGTAYCIIGPKGDVQPCAYLNIPLGNVKEMSFADIWKDNPVLKELRTMDYKGGCGTCGYKKVCGGCRARAYFYHGDYMAEEPWCLYHGRKGY GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 4->283|ALBA_BACSU|9e-23|27.7|267/448| SEG 289->304|kggcgtcgykkvcggc| BL:PDB:NREP 1 BL:PDB:REP 3->110|2fb2B|8e-10|32.4|108/326| RP:PDB:NREP 1 RP:PDB:REP 3->275|3cixA|1e-20|9.4|265/345| RP:PFM:NREP 1 RP:PFM:REP 8->110|PF04055|2e-11|43.4|99/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 6->161|PF04055|8.6e-31|27.7|155/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 3->267|1tv7A|2e-32|19.3|259/327|c.1.28.3| HM:SCP:REP 3->303|1tv8A_|1e-73|37.7|300/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 1071 OP:NHOMOORG 543 OP:PATTERN 221514433333334424332324333424322-22211111145443979A8413341-2222611- 34512-11------11144-41--1234333131112112-212----1------1----12211-21-1---------3551-22121111-1-1---------121-----------------23-433-134411112----1--12221-1---------1-1-111------------1111162--1122221--2-322--211221323--121--2-11----11---------------1---1----------11----------1--------1-11-------------------------11111111-5414334322322223-55-111-27123-324655462344532343---21---------12121-1-24311----------1-1121-311-1--1--12212-11111---2-111112-211111111122212-1---------------------------------------1211111-111111-11111-2-113111---111--11-1------11-1-11----------111-74353522442232454585A231121224A1--1---------11111111-11111----2-2----------------------1----1-1------121-1-11111111111-1111111111111111111-----1-------------------111111-------------------11111----2122----------------111-111---1111112322-212121111----1--------------------11111111-----112------------------------------------------2362223222212 ----1-----------1---------------------------------------------------------------------------1-----------------2-3-11111--11112---8D4-321--1111111-1-1-1--1-2111---11-----1-21-1----8-1----232-1---1-21- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 86.1 SQ:SECSTR #EEEEEEEcccccccTTcTTcTTccccccccHHHHHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHHHTTccEEEEEcccccHHHHHHHHHTTccEEEcccccccHHHHHHHHcTTccHHHHHHHHHHHHTTcEEEEccEEccTccHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHcTTccccccHHHHHHcTTHHHHHHTTTccEEccccccTTTGGGcccccccTTTTcHHTTTTccTTcHHHHHHHcccccccccc############################################# DISOP:02AL 326-331| PSIPRED cEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccHHHcHHHHHHHHHHHHcccEEEEEEccHHccHHHHHHHHHccccEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEEEccccccccHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccEEEEcccccEEEcccccccccccccccHHHHHHcHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccc //