[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50689.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:299 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   88->130 PF00395 * SLH 6e-06 32.6 43/45  
:HMM:PFM   154->189 PF00395 * SLH 1.1e-05 31.4 35/45  
:BLT:SWISS 118->212 GUN_BACS6 3e-04 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50689.1 GT:GENE ABO50689.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2375829..2376728) GB:FROM 2375829 GB:TO 2376728 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50689.1 GB:DB_XREF GI:134052718 LENGTH 299 SQ:AASEQ MRRQFGFLLIGATLIGAVSLWPIASGLADENINNTQQAQEQQVDDKKTNVSKTLPYITRAEAAELLVNSLELNLDGFRFYKAPEVSDFFDDVVAADPSANEIMILGYNGVLHTDDRSFCPSELITREEIAQICGGLLQRKAQGQVQMEVGPQINDLNKANKVAVDDIKLLVGLKIMVLTEDGNFQPDRGVLAEELKNVIKRLEPFLKVKTNDITAEVVTGKEGCREVEISWGEKPSSGYELTISKIDLQGNTLMVYYQTKEPTPSSYNSTVITEPKDSKPIPSNYPTKLDIKLVKDLKN GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 118->212|GUN_BACS6|3e-04|30.1|93/100| SEG 87->96|dffddvvaad| HM:PFM:NREP 2 HM:PFM:REP 88->130|PF00395|6e-06|32.6|43/45|SLH| HM:PFM:REP 154->189|PF00395|1.1e-05|31.4|35/45|SLH| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,274-283,299-300| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEcccHHHHHHHHHHcccccccEEEEEEEEcEEccEEEEEEccccccHHHccccccccccccccccccccccHHHHHHHHHcc //