[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50698.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50698.1 GT:GENE ABO50698.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2384794..2385189) GB:FROM 2384794 GB:TO 2385189 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_0100 hypothetical protein GB:PROTEIN_ID ABO50698.1 GB:DB_XREF GI:134052727 LENGTH 131 SQ:AASEQ MMKTVSCTVGEGRLKVHLVTTFTSEGLVCQLYGGEKYHVGAVVLSIPRPSLQDSVQISSNSSVLPLLGHKDDEIAKPLAESLAIYFKEPVVMVAGIHIDHATKEEINNIIKNCWQAAKKLMEGPQSNSKNK GT:EXON 1|1-131:0| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,53-61,121-132| PSIPRED cccEEEEEEEcccEEEEEEEEEccccEEEEEEccccccEEEEEEEcccccccccccccccccEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccc //