[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50731.1
DDBJ      :             protein of unknown function DUF134
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.13
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->90 1t11B PDBj 8e-04 28.8 %
:RPS:PDB   37->88 3dxjF PDBj 3e-05 25.0 %
:RPS:SCOP  31->77 1tc3C  a.4.1.2 * 1e-05 12.8 %
:HMM:SCOP  37->83 1iw7F2 a.4.13.2 * 0.00015 42.6 %
:RPS:PFM   1->94 PF02001 * DUF134 1e-19 51.1 %
:HMM:PFM   2->95 PF02001 * DUF134 1.1e-26 40.4 94/106  
:BLT:SWISS 1->99 Y1463_ALKMQ 4e-36 65.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50731.1 GT:GENE ABO50731.1 GT:PRODUCT protein of unknown function DUF134 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2426850..2427236) GB:FROM 2426850 GB:TO 2427236 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF134 GB:NOTE PFAM: protein of unknown function DUF134 KEGG: dsy:DSY3441 hypothetical protein GB:PROTEIN_ID ABO50731.1 GB:DB_XREF GI:134052760 InterPro:IPR002852 LENGTH 128 SQ:AASEQ MARPKKWRRVCILPEVNTFGPIDISESTREYIHMTVEEYETIRLMDLEGLNQEESADVMGVARSTIQRIYDNARKKLAESLVNGKVLKIEGGDYKLCNEFDDQRQCNRRTCRRNKHKDNVLIAIRECK GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 1->99|Y1463_ALKMQ|4e-36|65.7|99/116| SEG 101->114|ddqrqcnrrtcrrn| BL:PDB:NREP 1 BL:PDB:REP 18->90|1t11B|8e-04|28.8|73/374| RP:PDB:NREP 1 RP:PDB:REP 37->88|3dxjF|3e-05|25.0|52/349| RP:PFM:NREP 1 RP:PFM:REP 1->94|PF02001|1e-19|51.1|94/97|DUF134| HM:PFM:NREP 1 HM:PFM:REP 2->95|PF02001|1.1e-26|40.4|94/106|DUF134| RP:SCP:NREP 1 RP:SCP:REP 31->77|1tc3C|1e-05|12.8|47/51|a.4.1.2| HM:SCP:REP 37->83|1iw7F2|0.00015|42.6|47/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 123 OP:NHOMOORG 97 OP:PATTERN -----1--------------------------1-111-1-111-11-1-1232-1111111------- -------------------------------------------------------------------------------------------1-1-------------------------------22122122211-----111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111111-1-1-331---11-----1-111121111111111----------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------211-2-2---------1-1----------1----------------------1-----13---------122--1----11---1-----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------1113----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 57.0 SQ:SECSTR #################EEEEEEccTTccEEEEEEEHHHHHTTTTccTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTTcccGGEE###################################### DISOP:02AL 1-3| PSIPRED cccccccEEEEccccccEEEccccccccccEEEEEHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccEEEEEEcccEEEcHHHcccccHHHHHHHHccccccEEEEEEEcc //