[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50735.1
DDBJ      :             Cobyrinic acid a,c-diamide synthase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.116.1c.37.1d.58.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->126 1hfeL PDBj 6e-09 37.3 %
:RPS:PDB   61->114 1durA PDBj 4e-08 30.2 %
:RPS:PDB   90->270 3ea0B PDBj 3e-12 15.5 %
:RPS:SCOP  58->114 2v4jA1  d.58.1.5 * 1e-08 17.5 %
:RPS:SCOP  143->274 3bbdA1  c.116.1.6 * 2e-09 10.0 %
:HMM:SCOP  1->272 1ionA_ c.37.1.10 * 9.8e-30 27.6 %
:RPS:PFM   143->213 PF01656 * CbiA 9e-04 25.4 %
:HMM:PFM   3->243 PF01656 * CbiA 3.7e-28 30.2 169/194  
:BLT:SWISS 31->270 Y578_METJA 2e-24 32.2 %
:PROS 95->106|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50735.1 GT:GENE ABO50735.1 GT:PRODUCT Cobyrinic acid a,c-diamide synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2430127..2430957) GB:FROM 2430127 GB:TO 2430957 GB:DIRECTION - GB:PRODUCT Cobyrinic acid a,c-diamide synthase GB:NOTE PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain protein; Cobyrinic acid a,c-diamide synthase KEGG: tte:TTE1892 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain GB:PROTEIN_ID ABO50735.1 GB:DB_XREF GI:134052764 InterPro:IPR000437 InterPro:IPR001450 InterPro:IPR002586 LENGTH 276 SQ:AASEQ MKIAVLSGKGGTGKTTISASFAASIASCQYIDCDVEEPNGYIFLNPDIQRSQQVKVLVPEVDKAKCDGCGACGTACQFNAIAVLKGEVLLFHEICHHCGACVIACPRDAIYEQERMIGVIEANKNDNFLHGKLNVGEPISVPIIQELKNLIKKDKPVIIDCSPGASCAVVQSIEECDYCVLVTEPTPFGLHDLEIAVQLVRKMKMPFGIIINKASDDSKLIHDYCRSEGIKILMEIPFSTEIAKAYSEGILPIQKDIVLKQKFEKLYEKLVRGEYQ GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 31->270|Y578_METJA|2e-24|32.2|227/276| PROS 95->106|PS00198|4FE4S_FER_1|PDOC00176| SEG 8->27|gkggtgkttisasfaasias| BL:PDB:NREP 1 BL:PDB:REP 60->126|1hfeL|6e-09|37.3|67/396| RP:PDB:NREP 2 RP:PDB:REP 61->114|1durA|4e-08|30.2|53/55| RP:PDB:REP 90->270|3ea0B|3e-12|15.5|181/239| RP:PFM:NREP 1 RP:PFM:REP 143->213|PF01656|9e-04|25.4|71/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 3->243|PF01656|3.7e-28|30.2|169/194|CbiA| RP:SCP:NREP 2 RP:SCP:REP 58->114|2v4jA1|1e-08|17.5|57/81|d.58.1.5| RP:SCP:REP 143->274|3bbdA1|2e-09|10.0|130/204|c.116.1.6| HM:SCP:REP 1->272|1ionA_|9.8e-30|27.6|221/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 155 OP:NHOMOORG 75 OP:PATTERN ----1-----------2------2----------222-2222---2222422222222222---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---2222222-2---442-----------2122242221-2222-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222222222222-----2---42------22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--22-2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 88.8 SQ:SECSTR ###########################TcccTHHHHcccccEEEETTEHHHHHHHHHEEcccTTcccccccccTTcTTccEEEccccEETccccccccHHHHHHGGGGccHHHHHHcEEEETTEEEEcccccHHHHHTccHHHHHHHHHHHHTTccEEEEccccccTTHHHHGGGccEEEEEEcccHHHHHHHHHHHHHHTTccccEEEEETTTTcccccHHHHHHHHTccccEEccccHHHHHHHHHTHHHHcTTcHHHHHHHHHHTcccH#### DISOP:02AL 275-277| PSIPRED cEEEEEEccccccHHHHHHHHHHHHccEEEEEEEEccccccEEcccccccccEEEEEEEEEcHHHcccccHHHHHcccccEEEEccEEEEEHHHccccccHHHHccccEEEEEEEEccEEEEcccccEEEEEEEEEccccHHHHHHHHHHcccccEEEEEccccccHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHcccEEEEccccHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHcc //