[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50744.1
DDBJ      :             arsenate reductase and related
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:112 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->105 2kokA PDBj 3e-10 28.6 %
:RPS:SCOP  3->111 1rw1A  c.47.1.12 * 1e-10 24.8 %
:HMM:SCOP  2->111 1rw1A_ c.47.1.12 * 1.7e-22 34.5 %
:RPS:PFM   10->106 PF03960 * ArsC 1e-09 34.0 %
:HMM:PFM   6->106 PF03960 * ArsC 3.2e-21 33.7 101/112  
:BLT:SWISS 3->106 SPX_STAAW 1e-08 31.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50744.1 GT:GENE ABO50744.1 GT:PRODUCT arsenate reductase and related GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2438320..2438658) GB:FROM 2438320 GB:TO 2438658 GB:DIRECTION - GB:PRODUCT arsenate reductase and related GB:NOTE PFAM: arsenate reductase and related KEGG: cno:NT01CX_2298 arsenate reductase-like protein GB:PROTEIN_ID ABO50744.1 GB:DB_XREF GI:134052773 InterPro:IPR006660 LENGTH 112 SQ:AASEQ MNIQIFGIKKCFNTKKAERYFKERRIKYQFIDLSIKGLSQGELKSVAAAIGLNNLIDTQSKDYKKLCMDRIIGSSVREELLLNNPGLYKTPIVRNGKKATVGYEPEIWGIWE GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 3->106|SPX_STAAW|1e-08|31.4|102/131| BL:PDB:NREP 1 BL:PDB:REP 1->105|2kokA|3e-10|28.6|105/120| RP:PFM:NREP 1 RP:PFM:REP 10->106|PF03960|1e-09|34.0|97/111|ArsC| HM:PFM:NREP 1 HM:PFM:REP 6->106|PF03960|3.2e-21|33.7|101/112|ArsC| RP:SCP:NREP 1 RP:SCP:REP 3->111|1rw1A|1e-10|24.8|109/114|c.47.1.12| HM:SCP:REP 2->111|1rw1A_|1.7e-22|34.5|110/0|c.47.1.12|1/1|Thioredoxin-like| OP:NHOMO 56 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------1-------------------------1----------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------11111111111111111---1-----11--11-1-------------1--------------11111------------------------------111-1111111------------------------------------------------------------------------------------------------------------1-----1---------------------1-----------------------------1--1------------------------------1-----------------------1-------1------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 96.4 SQ:SECSTR ccEEEEEccccHHHHHHHHHHHHHTccEEEEEHHHHcccHHHHHHHHHHccGGGTcccccHHHHHccHHHcccHHHHHHHHHHcGGGccccEEEETTEEEEcccHHHH#### PSIPRED cEEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHccHHHHHHcccHHHHHccccccccHHHHHHHHHHcccEEEccEEEEccEEEEcccHHHHHHcc //