[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50748.1
DDBJ      :             extracellular solute-binding protein, family 3
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  566/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->261 1wdnA PDBj 9e-16 33.7 %
:RPS:PDB   40->263 3delB PDBj 2e-26 22.6 %
:RPS:SCOP  40->263 1gggA  c.94.1.1 * 3e-27 26.3 %
:HMM:SCOP  1->264 2a5sA1 c.94.1.1 * 4e-48 37.2 %
:RPS:PFM   47->266 PF00497 * SBP_bac_3 6e-26 35.1 %
:HMM:PFM   40->268 PF00497 * SBP_bac_3 2.5e-45 36.0 214/225  
:HMM:PFM   1->36 PF01298 * Lipoprotein_5 3.9e-05 37.1 35/593  
:BLT:SWISS 40->273 HISJ_CAMJE 3e-21 35.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50748.1 GT:GENE ABO50748.1 GT:PRODUCT extracellular solute-binding protein, family 3 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2444036..2444875) GB:FROM 2444036 GB:TO 2444875 GB:DIRECTION - GB:PRODUCT extracellular solute-binding protein, family 3 GB:NOTE PFAM: extracellular solute-binding protein, family 3 KEGG: dsy:DSY1207 hypothetical protein GB:PROTEIN_ID ABO50748.1 GB:DB_XREF GI:134052777 InterPro:IPR000437 InterPro:IPR001638 LENGTH 279 SQ:AASEQ MKKKISILIAMSLAVMLLLTGCGSGGSSETKKEKTGGTFKVGLECGYAPFNWTQMDDSNGAVKIDGNAEYAGGYDVEIAKKIAKGLGKELVIVKTEWDGLVPALTSGKIDAIIAGMSPTAERKKTIDFSDIYYKSDLVMVVKKGGKYEGAKSIQDFNGAKVTAQLNTFHYTVIDQIKGVAKQPAMDNFPAMRVALESGIIDGYVSERPEGVSASTANPNFAMVEFKEGFTTSDDDTAIAVGIAKGSELTEQINKILAGISEEERTQIMDSAIKNQPAAK GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 40->273|HISJ_CAMJE|3e-21|35.4|212/256| TM:NTM 1 TM:REGION 5->23| SEG 23->38|gsggssetkkektggt| BL:PDB:NREP 1 BL:PDB:REP 73->261|1wdnA|9e-16|33.7|178/223| RP:PDB:NREP 1 RP:PDB:REP 40->263|3delB|2e-26|22.6|208/232| RP:PFM:NREP 1 RP:PFM:REP 47->266|PF00497|6e-26|35.1|205/222|SBP_bac_3| HM:PFM:NREP 2 HM:PFM:REP 40->268|PF00497|2.5e-45|36.0|214/225|SBP_bac_3| HM:PFM:REP 1->36|PF01298|3.9e-05|37.1|35/593|Lipoprotein_5| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 40->263|1gggA|3e-27|26.3|205/220|c.94.1.1| HM:SCP:REP 1->264|2a5sA1|4e-48|37.2|242/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1957 OP:NHOMOORG 592 OP:PATTERN 11---1----------1-2121112--1--11------3222---112----1----1---------- --------------1------2---2------1----111-1-----1-11-1231--------111----42222112---1----------------------------------------------1--4------11--1----11--1-----------1--113-------------2441111--2223333344233334321212333321-33322222226322222222222222222222332466524345444772532422224443333355545656655563332333334333376877666412355332444422221332222121211-23155-5111-111111126---1---12112--11-1--1----4543425545D---1--2-218--94469768788911----12222212211111111----1-11----------111-11111111111--1-1-----24236DFFGGC34555BB49666657FA92431--33112-11-27513--1----532222222------1-6-545733866532-23-3----------3-5231333332-1--------21----453-1-----1-1111--11111111-11-1-1-1--------76784676665654566-6666566566656566557997984327566777777767667A565545621645555554555--2-111111111--214---111-1111-11-11111--233--55556B67457552544----------2225222222241111---------------5----------------32-2----------------------121-113111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 97.1 SQ:SECSTR TTTccccEEE########EEEEccHHHHHHHHHTTcTTEEEEEccccTTTcEEccccccccHHEcTTccEEcHHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEccEccccccccGGGcccEEEETTcHHHHHHHHcTTccEEEEccHHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEEEccGGGcEEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHHccccccc DISOP:02AL 1-1,27-31,277-280| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccEEEEEEcccccEEEEccccccccccccccccEEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEccccccccccHHHHcccEEEEEcccHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHcccccEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHcccccccc //