[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50757.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->68 PF09901 * DUF2128 1e-20 69.1 %
:HMM:PFM   1->69 PF09901 * DUF2128 6.7e-41 68.1 69/70  
:BLT:SWISS 3->68 Y352_TREPA 1e-18 56.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50757.1 GT:GENE ABO50757.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2455458..2455673) GB:FROM 2455458 GB:TO 2455673 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: lwe:lwe0546 hypothetical protein GB:PROTEIN_ID ABO50757.1 GB:DB_XREF GI:134052786 LENGTH 71 SQ:AASEQ MAEFKYEIIKTIGVLSEGSKGWQKELNLISWNDKPPKYDIREWSPDRQKMGKGVTLSEEEINVLKTLLAEI GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 3->68|Y352_TREPA|1e-18|56.1|66/100| RP:PFM:NREP 1 RP:PFM:REP 1->68|PF09901|1e-20|69.1|68/70|DUF2128| HM:PFM:NREP 1 HM:PFM:REP 1->69|PF09901|6.7e-41|68.1|69/70|DUF2128| OP:NHOMO 84 OP:NHOMOORG 82 OP:PATTERN --------------------------------------111-1------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----111111----------------------1----------------1-----11111111111111111111111111111111121111111111111-1-111111211-1-1-11----1--11--1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccHHHHcccccccHHHHHHHHHHHHHc //