[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50766.1
DDBJ      :             Peptidase M15A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.65.1
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->74 1lbuA2  d.65.1.1 * 5e-12 28.6 %
:HMM:SCOP  5->80 1lbuA2 d.65.1.1 * 5e-19 52.1 %
:RPS:PFM   7->70 PF08291 * Peptidase_M15_3 1e-12 51.6 %
:HMM:PFM   7->70 PF08291 * Peptidase_M15_3 6.2e-20 46.9 64/110  
:BLT:SWISS 6->78 YCBK_SHIFL 3e-05 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50766.1 GT:GENE ABO50766.1 GT:PRODUCT Peptidase M15A GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2468035..2468277) GB:FROM 2468035 GB:TO 2468277 GB:DIRECTION - GB:PRODUCT Peptidase M15A GB:NOTE PFAM: Peptidase M15A KEGG: vvy:VV0627 hypothetical protein GB:PROTEIN_ID ABO50766.1 GB:DB_XREF GI:134052795 InterPro:IPR013230 LENGTH 80 SQ:AASEQ MEELFKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGLYPSQCFVHVDVRGYCARWEG GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 6->78|YCBK_SHIFL|3e-05|36.1|72/182| RP:PFM:NREP 1 RP:PFM:REP 7->70|PF08291|1e-12|51.6|64/103|Peptidase_M15_3| HM:PFM:NREP 1 HM:PFM:REP 7->70|PF08291|6.2e-20|46.9|64/110|Peptidase_M15_3| RP:SCP:NREP 1 RP:SCP:REP 5->74|1lbuA2|5e-12|28.6|70/130|d.65.1.1| HM:SCP:REP 5->80|1lbuA2|5e-19|52.1|73/0|d.65.1.1|1/1|Hedgehog/DD-peptidase| OP:NHOMO 14 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32---------------------------------3----------------------------------------------------------------------------------1-21--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,79-81| PSIPRED ccccEEEEEEcccccHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHccccEEEEEccccEEEEEcccccccccc //