[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50806.1
DDBJ      :             phosphate ABC transporter, inner membrane subunit PstC
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  783/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->206 3dhwA PDBj 4e-05 23.5 %
:RPS:PDB   170->209 3dhwA PDBj 1e-05 30.0 %
:RPS:SCOP  32->235 2r6gG1  f.58.1.1 * 3e-17 13.6 %
:RPS:PFM   107->226 PF00528 * BPD_transp_1 2e-05 31.7 %
:HMM:PFM   88->287 PF00528 * BPD_transp_1 1.7e-23 24.3 181/185  
:BLT:SWISS 46->258 YQGH_BACSU 1e-36 37.1 %
:TM
:REPEAT 2|92->159|171->232
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50806.1 GT:GENE ABO50806.1 GT:PRODUCT phosphate ABC transporter, inner membrane subunit PstC GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2510751..2511638 GB:FROM 2510751 GB:TO 2511638 GB:DIRECTION + GB:PRODUCT phosphate ABC transporter, inner membrane subunit PstC GB:NOTE TIGRFAM: phosphate ABC transporter, inner membrane subunit PstC PFAM: binding-protein-dependent transport systems inner membrane component KEGG: mhu:Mhun_2982 phosphate ABC transporter, permease protein PstC GB:PROTEIN_ID ABO50806.1 GB:DB_XREF GI:134052835 InterPro:IPR000515 InterPro:IPR011864 LENGTH 295 SQ:AASEQ MLNKKSFHLSTGTFCLVIACCATLLLLSLLVYMTLVSWPVWFSPGPWGFLTGTDWNPLAAPPQLGIGTMILSTLWTALGAVILATPIGLCCAIFLAEYAPSWLAQLLRPVLNVLTGIPSVVYGFLGAAVLVKYFEITFNMASGESLFCASLVLTVMVLPYIVSASESALRAIPLKYRQTSLALGVSKPYFTLRVLIPLARNGLLGALILAFGRASGETMAVLMLAGNTMVLPSSWFSKGEPLSALIALELGTSEVGSLHYQSLFAAGLVLLLFVLSINLFFTWFRRDRRNEVGKP GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 46->258|YQGH_BACSU|1e-36|37.1|213/309| TM:NTM 7 TM:REGION 11->33| TM:REGION 70->92| TM:REGION 108->130| TM:REGION 144->166| TM:REGION 190->212| TM:REGION 218->240| TM:REGION 261->283| NREPEAT 1 REPEAT 2|92->159|171->232| SEG 24->30|llllsll| SEG 262->281|slfaaglvlllfvlsinlff| BL:PDB:NREP 1 BL:PDB:REP 65->206|3dhwA|4e-05|23.5|136/203| RP:PDB:NREP 1 RP:PDB:REP 170->209|3dhwA|1e-05|30.0|40/203| RP:PFM:NREP 1 RP:PFM:REP 107->226|PF00528|2e-05|31.7|120/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 88->287|PF00528|1.7e-23|24.3|181/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 32->235|2r6gG1|3e-17|13.6|199/284|f.58.1.1| OP:NHOMO 1883 OP:NHOMOORG 842 OP:PATTERN 222112--1111121-2-11-22244432434222223333323111122521122-22-2---2-22 22--422222222233433-3222323333322222342422222212222222222222114221223222222222-122122222222212--------2--22-1----------------22132422212222242222244424463222222222242564622222222222222222222-2224444444444444442222224442422222222222242222222222222222222222412212222222222221222222444444422244444445444222222222222222222222242242323233332222222-222422235122322742-412222222--222222222222142121111211111111111111-22222222212232241123312214-22233222222222222222244211222212222222---------------2222222221222222222222122222222222222222222-222231122122222324222224-------111212226231223123332422222454221222462--22222222---------2222244222222221242222222422222444242--24112------22332232222222222-2222222222222222222222332222222222222222222322222222-233333323333--22---------222321221---2222---222222222221211111113233312222---------24444444444444422222221112222--21------22222222--2----1---1-111----111--1111322222222222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 47.1 SQ:SECSTR ################################################################HHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTccccccHHHHHHHHHHHHHHccHHHH####HHHHHHHHHHTTccccc##HHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHH###################################################################################### DISOP:02AL 1-5,291-296| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //